Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 mitochondrial 37S ribosomal protein PET123


LOCUS       XM_706164                906 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C600550WA), partial mRNA.
ACCESSION   XM_706164
VERSION     XM_706164.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 906)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 906)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 906)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 906)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_706164.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>906
                     /locus_tag="CAALFM_C600550WA"
                     /db_xref="GeneID:3647144"
     CDS             1..906
                     /locus_tag="CAALFM_C600550WA"
                     /note="Ortholog(s) have structural constituent of ribosome
                     activity and mitochondrial small ribosomal subunit
                     localization"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="XP_711256.1"
                     /db_xref="CGD:CAL0000175745"
                     /db_xref="GeneID:3647144"
                     /translation="MGRNVLKYGGKSGILPKVRPIFRKPIRPPTEYEQAKEHSIETGY
                     AEGIPLPKINGKEVSRKQPPKKYVTVEQRINQIKFPELTLKQMNELPEEERDAYKRQY
                     YRAQFLKDAYLQEEKRLNRIDELKEKVHQQNLERQARLQQEEKLEHQNKNIEGLPTMQ
                     ALLDKGMMRRRTKEEIELLKEQRNLNRKLKELQDKENQAQKVLELYHAAANFITTEEQ
                     LEEAIHRAFEVDVGVFEGKHTTIEAKLENRSLGYLTAEANEQKITDVVLGEIDGKPGL
                     QQVKELLSGEREKVKRQAQLNLKNN"
     misc_feature    25..681
                     /locus_tag="CAALFM_C600550WA"
                     /note="Saccharomyces cerevisiae mitochondrial small
                     ribosomal subunit protein mS26 and similar proteins;
                     Region: mS26_PET12; cd23703"
                     /db_xref="CDD:467916"
ORIGIN      
        1 atgggtagaa acgtattaaa atatggaggt aaatcaggga tattaccaaa agtaagacca
       61 attttcagaa aaccaatccg tccacccact gaatacgaac aagcaaaaga acacagtata
      121 gagactgggt atgctgaagg tattccttta ccaaaaatta acgggaaaga agtctctcgt
      181 aaacaaccac caaagaaata tgtcactgtt gaacaaagaa taaatcagat taagtttcca
      241 gaattgacat taaaacagat gaatgagtta cccgaagaag aaagagacgc ttataaaaga
      301 caatattatc gtgctcaatt cttgaaagat gcatacttac aagaagagaa aagattaaat
      361 agaattgatg aattgaaaga aaaagtgcat caacaaaatt tggaacgtca agcacgtttg
      421 caacaagaag aaaaattgga acaccaaaat aaaaacattg aaggattacc gaccatgcaa
      481 gcattattag ataaaggtat gatgagaaga cgaactaaag aagaaattga attattaaaa
      541 gagcaaagaa atttgaatag aaaattgaag gagttacaag ataaggaaaa ccaagcacag
      601 aaggtgttag aattgtacca tgccgctgct aattttatca ctactgaaga acagttggaa
      661 gaggctatac atagagcatt tgaagtggat gttggtgtct ttgaaggaaa gcacactaca
      721 attgaagcca aattggagaa tagactgttg ggctacttga ctgctgaagc taatgaacaa
      781 aagattacag atgtagtgtt gggtgaaatt gatggtaaac caggattaca acaagttaaa
      841 gaattgttga gtggagaaag agagaaggtc aaaagacaag ctcaattgaa cctcaaaaac
      901 aactaa