Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706164 906 bp mRNA linear PLN 18-APR-2022 (CAALFM_C600550WA), partial mRNA. ACCESSION XM_706164 VERSION XM_706164.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 906) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 906) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 906) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 906) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_706164.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..906 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>906 /locus_tag="CAALFM_C600550WA" /db_xref="GeneID:3647144" CDS 1..906 /locus_tag="CAALFM_C600550WA" /note="Ortholog(s) have structural constituent of ribosome activity and mitochondrial small ribosomal subunit localization" /codon_start=1 /transl_table=12 /product="mitochondrial 37S ribosomal protein PET123" /protein_id="XP_711256.1" /db_xref="CGD:CAL0000175745" /db_xref="GeneID:3647144" /translation="MGRNVLKYGGKSGILPKVRPIFRKPIRPPTEYEQAKEHSIETGY AEGIPLPKINGKEVSRKQPPKKYVTVEQRINQIKFPELTLKQMNELPEEERDAYKRQY YRAQFLKDAYLQEEKRLNRIDELKEKVHQQNLERQARLQQEEKLEHQNKNIEGLPTMQ ALLDKGMMRRRTKEEIELLKEQRNLNRKLKELQDKENQAQKVLELYHAAANFITTEEQ LEEAIHRAFEVDVGVFEGKHTTIEAKLENRSLGYLTAEANEQKITDVVLGEIDGKPGL QQVKELLSGEREKVKRQAQLNLKNN" misc_feature 25..681 /locus_tag="CAALFM_C600550WA" /note="Saccharomyces cerevisiae mitochondrial small ribosomal subunit protein mS26 and similar proteins; Region: mS26_PET12; cd23703" /db_xref="CDD:467916" ORIGIN 1 atgggtagaa acgtattaaa atatggaggt aaatcaggga tattaccaaa agtaagacca 61 attttcagaa aaccaatccg tccacccact gaatacgaac aagcaaaaga acacagtata 121 gagactgggt atgctgaagg tattccttta ccaaaaatta acgggaaaga agtctctcgt 181 aaacaaccac caaagaaata tgtcactgtt gaacaaagaa taaatcagat taagtttcca 241 gaattgacat taaaacagat gaatgagtta cccgaagaag aaagagacgc ttataaaaga 301 caatattatc gtgctcaatt cttgaaagat gcatacttac aagaagagaa aagattaaat 361 agaattgatg aattgaaaga aaaagtgcat caacaaaatt tggaacgtca agcacgtttg 421 caacaagaag aaaaattgga acaccaaaat aaaaacattg aaggattacc gaccatgcaa 481 gcattattag ataaaggtat gatgagaaga cgaactaaag aagaaattga attattaaaa 541 gagcaaagaa atttgaatag aaaattgaag gagttacaag ataaggaaaa ccaagcacag 601 aaggtgttag aattgtacca tgccgctgct aattttatca ctactgaaga acagttggaa 661 gaggctatac atagagcatt tgaagtggat gttggtgtct ttgaaggaaa gcacactaca 721 attgaagcca aattggagaa tagactgttg ggctacttga ctgctgaagc taatgaacaa 781 aagattacag atgtagtgtt gggtgaaatt gatggtaaac caggattaca acaagttaaa 841 gaattgttga gtggagaaag agagaaggtc aaaagacaag ctcaattgaa cctcaaaaac 901 aactaa