Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Yhm2p (YHM2), partial mRNA.


LOCUS       XM_706157                906 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_706157
VERSION     XM_706157.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 906)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 906)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 906)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 906)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_706157.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>906
                     /gene="YHM2"
                     /locus_tag="CAALFM_C600600CA"
                     /db_xref="GeneID:3647137"
     CDS             1..906
                     /gene="YHM2"
                     /locus_tag="CAALFM_C600600CA"
                     /note="Predicted carrier protein; exports citrate from and
                     imports oxoglutarate into the mitochondrion; alkaline
                     induced; Spider biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="Yhm2p"
                     /protein_id="XP_711249.1"
                     /db_xref="CGD:CAL0000182355"
                     /db_xref="GeneID:3647137"
                     /translation="MSKQIEKKPISFANIALGAGLNLAEVTTLGQPLEVIKTTMAANR
                     SLTMPQAAKFVWSRGGILGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFKKLGMNNF
                     VSGMGGGITGGLAQAYLTMGFCTCMKTVEITRSKQANTPGVPQQTSFQVFKEIYRKEG
                     IRGINKGVNAVAIRQMTNWGSRFGFSRLAEESIRSLTGKSESQKLSAWEKIASSVIGG
                     GLSAWNQPIEVIRVEMQSKTNDPNRPKNLSVAGAFKYIYQQNGIKGLYRGVTPRIGLG
                     VWQTVFMVAFGDIFKRMLNTDGTGH"
     misc_feature    79..258
                     /gene="YHM2"
                     /locus_tag="CAALFM_C600600CA"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    <409..555
                     /gene="YHM2"
                     /locus_tag="CAALFM_C600600CA"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    607..894
                     /gene="YHM2"
                     /locus_tag="CAALFM_C600600CA"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
ORIGIN      
        1 atgtctaaac aaattgaaaa gaaaccaatc agctttgcta atattgctct tggggcaggt
       61 ttaaaccttg ctgaagtgac tactttgggt caaccattag aggtcattaa aaccaccatg
      121 gctgccaatc gttctttgac catgccacaa gctgctaaat ttgtttggtc tcgtggcggg
      181 attttaggat tctatcaagg tttgatccca tgggcttgga ttgaagccag tactaaaggt
      241 gctgtgttat tgtttgtttc tgctgaagcc gaataccaat tcaagaaatt gggtatgaac
      301 aactttgtca gtggaatggg tggtggtatc actggtgggt tagcacaagc ttatttgact
      361 atgggattct gtacatgtat gaaaactgtg gaaatcactc gttccaaaca agccaatact
      421 ccaggtgtac cacaacaaac ttcattccaa gtattcaaag aaatttaccg taaagaaggg
      481 attagaggta taaataaagg tgtcaatgct gttgccatta gacaaatgac caattggggt
      541 tcaagattcg ggttcagtag attggctgaa gaatcaatca gaagtttgac cgggaaatca
      601 gaatcacaaa agttgctggc ctgggaaaag attgccagta gtgttattgg tggtgggttg
      661 agtgcttgga accagccaat tgaagttatt agagttgaaa tgcaaagtaa aacaaatgat
      721 ccgaaccgtc caaagaactt gagtgttgct ggggctttca aatacattta ccaacaaaat
      781 ggtatcaagg gtttatatag aggtgtcact ccaagaattg ggttaggtgt ttggcaaaca
      841 gtgtttatgg ttgcctttgg tgatatcttt aaaagaatgt tgaataccga tggtactggt
      901 cattaa