Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706157 906 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_706157 VERSION XM_706157.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 906) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 906) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 906) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 906) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_706157.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..906 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>906 /gene="YHM2" /locus_tag="CAALFM_C600600CA" /db_xref="GeneID:3647137" CDS 1..906 /gene="YHM2" /locus_tag="CAALFM_C600600CA" /note="Predicted carrier protein; exports citrate from and imports oxoglutarate into the mitochondrion; alkaline induced; Spider biofilm repressed" /codon_start=1 /transl_table=12 /product="Yhm2p" /protein_id="XP_711249.1" /db_xref="CGD:CAL0000182355" /db_xref="GeneID:3647137" /translation="MSKQIEKKPISFANIALGAGLNLAEVTTLGQPLEVIKTTMAANR SLTMPQAAKFVWSRGGILGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFKKLGMNNF VSGMGGGITGGLAQAYLTMGFCTCMKTVEITRSKQANTPGVPQQTSFQVFKEIYRKEG IRGINKGVNAVAIRQMTNWGSRFGFSRLAEESIRSLTGKSESQKLSAWEKIASSVIGG GLSAWNQPIEVIRVEMQSKTNDPNRPKNLSVAGAFKYIYQQNGIKGLYRGVTPRIGLG VWQTVFMVAFGDIFKRMLNTDGTGH" misc_feature 79..258 /gene="YHM2" /locus_tag="CAALFM_C600600CA" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature <409..555 /gene="YHM2" /locus_tag="CAALFM_C600600CA" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 607..894 /gene="YHM2" /locus_tag="CAALFM_C600600CA" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" ORIGIN 1 atgtctaaac aaattgaaaa gaaaccaatc agctttgcta atattgctct tggggcaggt 61 ttaaaccttg ctgaagtgac tactttgggt caaccattag aggtcattaa aaccaccatg 121 gctgccaatc gttctttgac catgccacaa gctgctaaat ttgtttggtc tcgtggcggg 181 attttaggat tctatcaagg tttgatccca tgggcttgga ttgaagccag tactaaaggt 241 gctgtgttat tgtttgtttc tgctgaagcc gaataccaat tcaagaaatt gggtatgaac 301 aactttgtca gtggaatggg tggtggtatc actggtgggt tagcacaagc ttatttgact 361 atgggattct gtacatgtat gaaaactgtg gaaatcactc gttccaaaca agccaatact 421 ccaggtgtac cacaacaaac ttcattccaa gtattcaaag aaatttaccg taaagaaggg 481 attagaggta taaataaagg tgtcaatgct gttgccatta gacaaatgac caattggggt 541 tcaagattcg ggttcagtag attggctgaa gaatcaatca gaagtttgac cgggaaatca 601 gaatcacaaa agttgctggc ctgggaaaag attgccagta gtgttattgg tggtgggttg 661 agtgcttgga accagccaat tgaagttatt agagttgaaa tgcaaagtaa aacaaatgat 721 ccgaaccgtc caaagaactt gagtgttgct ggggctttca aatacattta ccaacaaaat 781 ggtatcaagg gtttatatag aggtgtcact ccaagaattg ggttaggtgt ttggcaaaca 841 gtgtttatgg ttgcctttgg tgatatcttt aaaagaatgt tgaataccga tggtactggt 901 cattaa