Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 NADHX dehydratase (CAALFM_C602030CA),


LOCUS       XM_705754               1134 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_705754
VERSION     XM_705754.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1134)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1134)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1134)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1134)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1134)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1134)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_705754.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1134
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1134
                     /locus_tag="CAALFM_C602030CA"
                     /db_xref="GeneID:3647562"
     CDS             1..1134
                     /locus_tag="CAALFM_C602030CA"
                     /note="Putative protein of unknown function; stationary
                     phase enriched protein"
                     /codon_start=1
                     /transl_table=12
                     /product="NADHX dehydratase"
                     /protein_id="XP_710846.2"
                     /db_xref="CGD:CAL0000185966"
                     /db_xref="GeneID:3647562"
                     /translation="MLRNKSQKELLHLSRQLIQPLLPNFHKGQAGKIVVIGGNEDYTG
                     APFFASHSAALVGADLSHVICEKAAGPVIKSYSPDLMIHPYLMDLDNPHLNLNNSELE
                     KLKNLPIDEIIKTNDNAVLNKLIDELILPKVTSLLNRIDIVVVGPGFGRDPLMLKSLI
                     RIIEEVKVLNLPIILDADSLYLVSLSPKIIANYPKAIITPNVVEFQRIAKALSIDADL
                     SESNKDKLIDQTIEVSRKLGDIIVFRKGEHDLIVKSSKFLINEITGSNKRVGGQGDTL
                     TGAIATLVNWSNNYILRLWDNQVVVNWSNNYILRLWDNQVDLDQEDANLLACFAASSV
                     VRNASSKAFNKYGRSMQTSNVHEYLHESFTELFGDSIFRTSNI"
     misc_feature    67..1059
                     /locus_tag="CAALFM_C602030CA"
                     /note="B.subtilis YXKO protein of unknown function and
                     related proteins. Based on the conservation of the ATP
                     binding site, the substrate binding site and the
                     Mg2+binding site and structural homology this group is a
                     member of the ribokinase-like superfamily; Region:
                     YXKO-related; cd01171"
                     /db_xref="CDD:238576"
     misc_feature    order(142..144,811..813,820..822)
                     /locus_tag="CAALFM_C602030CA"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238576"
     misc_feature    order(601..603,733..735,814..819,826..828,994..996)
                     /locus_tag="CAALFM_C602030CA"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238576"
ORIGIN      
        1 atgctacgca ataaatctca aaaagaactc cttcatttat ctcgtcaatt gatccaacca
       61 ctattgccaa acttccacaa gggtcaagcg ggtaagattg ttgttattgg gggtaatgaa
      121 gattatactg gagcaccatt ttttgcaagt cattcagccg ctttagtagg tgctgatttg
      181 tcccatgtaa tatgtgaaaa ggctgctggt ccagtgataa aatcgtattc ccctgattta
      241 atgatccatc cttatttaat ggatttggac aacccacatt tgaatttgaa caattctgaa
      301 cttgaaaaat taaagaattt gcccatcgat gaaattatta aaacgaatga caatgcagtg
      361 ttgaataaac ttattgatga gctaatttta cccaaagtaa catcattgtt gaatagaatt
      421 gatatagttg ttgttggacc aggttttggt agagatccat taatgttaaa gtcattgatt
      481 cgaattattg aggaagtcaa agtgttgaat ttgcccatta tattagatgc tgactcgttg
      541 tatctagtat cgttgtctcc caaaattatt gcaaattatc caaaagccat catcacaccc
      601 aatgtggttg aattccaaag aatcgccaaa gccttatcaa tcgatgccga tttgtcagaa
      661 tcaaataagg ataagttaat tgatcaaacc attgaagtgt cacgcaaact aggtgacatt
      721 attgttttcc gtaaaggtga acacgacttg attgtcaaat catccaagtt tttaatcaat
      781 gaaattactg ggtccaataa acgagtaggt ggacaaggtg atacattaac aggagcaatt
      841 gcaactttgg tcaattggtc aaataattat attttgagat tatgggacaa tcaagttgtg
      901 gtcaattggt caaataatta tattttgaga ttatgggaca atcaagttga tttggatcaa
      961 gaagatgcta atttattagc atgttttgct gctagttcgg ttgttagaaa tgcaagtagt
     1021 aaggcattta acaaatacgg gagatcaatg cagacatcaa acgttcatga atatttacat
     1081 gaatcgttta cagaattatt tggtgacagt atatttagaa ccagtaatat ttga