Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705754 1134 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_705754 VERSION XM_705754.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1134) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1134) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1134) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1134) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1134) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1134) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_705754.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1134 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1134 /locus_tag="CAALFM_C602030CA" /db_xref="GeneID:3647562" CDS 1..1134 /locus_tag="CAALFM_C602030CA" /note="Putative protein of unknown function; stationary phase enriched protein" /codon_start=1 /transl_table=12 /product="NADHX dehydratase" /protein_id="XP_710846.2" /db_xref="CGD:CAL0000185966" /db_xref="GeneID:3647562" /translation="MLRNKSQKELLHLSRQLIQPLLPNFHKGQAGKIVVIGGNEDYTG APFFASHSAALVGADLSHVICEKAAGPVIKSYSPDLMIHPYLMDLDNPHLNLNNSELE KLKNLPIDEIIKTNDNAVLNKLIDELILPKVTSLLNRIDIVVVGPGFGRDPLMLKSLI RIIEEVKVLNLPIILDADSLYLVSLSPKIIANYPKAIITPNVVEFQRIAKALSIDADL SESNKDKLIDQTIEVSRKLGDIIVFRKGEHDLIVKSSKFLINEITGSNKRVGGQGDTL TGAIATLVNWSNNYILRLWDNQVVVNWSNNYILRLWDNQVDLDQEDANLLACFAASSV VRNASSKAFNKYGRSMQTSNVHEYLHESFTELFGDSIFRTSNI" misc_feature 67..1059 /locus_tag="CAALFM_C602030CA" /note="B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily; Region: YXKO-related; cd01171" /db_xref="CDD:238576" misc_feature order(142..144,811..813,820..822) /locus_tag="CAALFM_C602030CA" /note="putative substrate binding site [chemical binding]; other site" /db_xref="CDD:238576" misc_feature order(601..603,733..735,814..819,826..828,994..996) /locus_tag="CAALFM_C602030CA" /note="putative ATP binding site [chemical binding]; other site" /db_xref="CDD:238576" ORIGIN 1 atgctacgca ataaatctca aaaagaactc cttcatttat ctcgtcaatt gatccaacca 61 ctattgccaa acttccacaa gggtcaagcg ggtaagattg ttgttattgg gggtaatgaa 121 gattatactg gagcaccatt ttttgcaagt cattcagccg ctttagtagg tgctgatttg 181 tcccatgtaa tatgtgaaaa ggctgctggt ccagtgataa aatcgtattc ccctgattta 241 atgatccatc cttatttaat ggatttggac aacccacatt tgaatttgaa caattctgaa 301 cttgaaaaat taaagaattt gcccatcgat gaaattatta aaacgaatga caatgcagtg 361 ttgaataaac ttattgatga gctaatttta cccaaagtaa catcattgtt gaatagaatt 421 gatatagttg ttgttggacc aggttttggt agagatccat taatgttaaa gtcattgatt 481 cgaattattg aggaagtcaa agtgttgaat ttgcccatta tattagatgc tgactcgttg 541 tatctagtat cgttgtctcc caaaattatt gcaaattatc caaaagccat catcacaccc 601 aatgtggttg aattccaaag aatcgccaaa gccttatcaa tcgatgccga tttgtcagaa 661 tcaaataagg ataagttaat tgatcaaacc attgaagtgt cacgcaaact aggtgacatt 721 attgttttcc gtaaaggtga acacgacttg attgtcaaat catccaagtt tttaatcaat 781 gaaattactg ggtccaataa acgagtaggt ggacaaggtg atacattaac aggagcaatt 841 gcaactttgg tcaattggtc aaataattat attttgagat tatgggacaa tcaagttgtg 901 gtcaattggt caaataatta tattttgaga ttatgggaca atcaagttga tttggatcaa 961 gaagatgcta atttattagc atgttttgct gctagttcgg ttgttagaaa tgcaagtagt 1021 aaggcattta acaaatacgg gagatcaatg cagacatcaa acgttcatga atatttacat 1081 gaatcgttta cagaattatt tggtgacagt atatttagaa ccagtaatat ttga