Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705745 1092 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_705745 VERSION XM_705745.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1092) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1092) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1092) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1092) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1092) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1092) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_705745.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1092 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1092 /locus_tag="CAALFM_C602110WA" /db_xref="GeneID:3647553" CDS 1..1092 /locus_tag="CAALFM_C602110WA" /note="Ortholog of C. dubliniensis CD36 : Cd36_62270, C. parapsilosis CDC317 : CPAR2_602240, Candida tenuis NRRL Y-1498 : CANTEDRAFT_114419 and Debaryomyces hansenii CBS767 : DEHA2E04884g" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_710837.1" /db_xref="CGD:CAL0000185066" /db_xref="GeneID:3647553" /translation="MENLYTALSISLITDDKRFVFVSDDSNKAIPKFTSMLVNTCSFD TSQYCVIDLLNVHTTIDLIHQMTNFRDNQYFLKNIIIWQNVQYLTTNQHKSLYKLILQ IDQFGLRGVRGKPIDIAIGNDEIISINRPQLFTIIMAFDYKAFSKKLYIYLKEKFWFA VNYNNVEEEDEQESDGLPQDSQYQETILGLRNSLADVFISPDIKGYIYSLIVFTRCHR LASLSPKSTRLPTMAIDYMHDFCKCLALWKNQSKLNQELFITPAYVKLAFRKIGYWLV DWEYNEMFAKDTQSSVLVDDDSNTLNNEIDYQKRLEISMLTGDWYGSDYFFVNEYLKS SKSKLDKKSSTGYTNKIIEDVISSVRPPL" ORIGIN 1 atggagaact tatatacagc attatctata tcattaatta cagacgataa acgattcgtt 61 tttgtttcag atgattccaa taaagccatt cctaaattta caagtatgtt agtcaatact 121 tgttcatttg atacatcaca atattgtgtg attgatctac taaatgttca cacgactatc 181 gatttgatcc atcaaatgac taattttcgt gacaatcaat actttttgaa aaacattatt 241 atttggcaaa atgttcagta tttgacaacc aaccagcata aatcattgta taaactaatt 301 ttacaaatag accaatttgg attgagagga gttaggggca agccaattga tatagccatt 361 ggaaatgatg aaattatatc aattaatagg ccacaattgt tcacgattat tatggctttt 421 gattataagg cattcagcaa aaagttgtat atatatttaa aagaaaaatt ctggtttgct 481 gtaaattaca acaacgtgga agaggaagat gagcaagagt cagatggact tccacaggat 541 tcacaatatc aagagactat attaggatta agaaatagcc tagctgatgt gtttatctcc 601 cctgacatca agggatacat atattcattg attgttttca cccgatgtca tagattagca 661 tctttgtcac caaaactgac aaggctacca acaatggcaa ttgattatat gcatgatttc 721 tgcaaatgtt tagcattatg gaaaaaccaa ctgaaattaa accaagagtt atttatcacc 781 ccagcatatg tcaagttggc attcagaaaa attggctact ggttagtcga ttgggagtat 841 aatgaaatgt ttgctaaaga cactcaaagt agtgtgttag ttgatgatga tagtaacact 901 ttgaataatg aaatagatta tcaaaagaga ttagaaataa gtatgctcac aggtgattgg 961 tatggtagtg attatttttt tgttaatgaa tatttaaaga gtagtaaaag taagttggat 1021 aaaaaaagtt ccactggtta taccaacaag atcattgaag atgtaattag ttcagtaagg 1081 ccaccattat ag