Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Ctf5p (CTF5), partial mRNA.


LOCUS       XM_705742               1101 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_705742
VERSION     XM_705742.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1101)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1101)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1101)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1101)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1101)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1101)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_705742.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1101
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1101
                     /gene="CTF5"
                     /locus_tag="CAALFM_C602130CA"
                     /db_xref="GeneID:3647550"
     CDS             1..1101
                     /gene="CTF5"
                     /locus_tag="CAALFM_C602130CA"
                     /note="Predicted component of the kinetochore sub-complex
                     COMA; induced during the mating process; repressed by
                     alpha pheromone in SpiderM medium"
                     /codon_start=1
                     /transl_table=12
                     /product="Ctf5p"
                     /protein_id="XP_710834.2"
                     /db_xref="CGD:CAL0000182597"
                     /db_xref="GeneID:3647550"
                     /translation="MDSVEIDQINNIEKEIDEIKADIALIEKDLTSNQLQKQQLQEEI
                     EALVLEQQKQAQDKTKESPVPSGPDDMDIEIPEIIKHNYFDPSIQKYFQQSTSPSNQS
                     SLPENATTKIASSQLKPINDLELKENVLYENIFRMFGITAFPINQYLFKNNDDPNEQI
                     LGLRFDLYSNFTKRFQQPHYCILRKLPFEKNDSILYNWIVYKHTLPSYIPIDEYSKIL
                     NENDNENDNGNQNNSLFKFAESIQLTLTKTQYKLDKFNQLLRFNKNQFGLDKDEAIFI
                     NLDCDLLGQRILLNLSHNSKTQIKKTQMMGVELICSNDLIEVIHFNNFPDIIHSNQLL
                     ICQTILQNSKINDLIKNFRKVIQILVKYKVIE"
     misc_feature    418..1056
                     /gene="CTF5"
                     /locus_tag="CAALFM_C602130CA"
                     /note="Cenp-O kinetochore centromere component; Region:
                     CENP-O; pfam09496"
                     /db_xref="CDD:430646"
ORIGIN      
        1 atggactctg ttgaaattga tcaaattaat aatattgaaa aggagataga tgaaatcaaa
       61 gctgatatag cattaataga aaaagatcta acatcaaatc aattgcaaaa acaacagtta
      121 caagaagaga ttgaagcttt ggtattagag caacaaaaac aggctcaaga caaaacaaag
      181 gaatcgcctg tccccagtgg tcctgatgat atggatattg aaatacctga aattataaaa
      241 cataattatt ttgatcctag tatccaaaaa tatttccaac aatcaacttc tccatcaaac
      301 caactgtctc ttcctgaaaa tgccacaact aaaattgcat catctcaatt aaagcctatc
      361 aatgacttgg aattgaaaga aaatgtgcta tatgaaaata ttttccgaat gtttggtata
      421 actgcattcc cgataaatca atacttgttc aaaaataatg atgaccccaa tgaacagatt
      481 ctagggttac gatttgatct ttattcaaat tttactaaac gtttccagca acctcattat
      541 tgtatacttc ggaaattacc atttgaaaaa aacgacagca tactttataa ttggatagtt
      601 tataaacata cattaccgtc atatatccca attgatgaat attccaaaat cttgaatgaa
      661 aacgataatg aaaacgataa tggtaaccaa aataatagct tgtttaaatt tgctgaatcc
      721 attcaattaa cattaaccaa gacccagtat aaattagaca aattcaatca acttttgcga
      781 tttaacaaaa atcaatttgg tttggataaa gatgaagcga ttttcataaa tttagattgt
      841 gatttgctag gtcaacgaat attgttgaat ttaagtcata actctaaaac ccaaataaag
      901 aaaactcaaa tgatgggggt tgaattgatt tgttctaatg atttaattga agttatacat
      961 ttcaataatt tcccagatat catccactct aatcaattat tgatttgtca gactatatta
     1021 caaaactcca aaattaatga tttgattaaa aactttagaa aagttattca gattttagtt
     1081 aaatacaaag taatagaata a