Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705478 1323 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_705478 VERSION XM_705478.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1323) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1323) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1323) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1323) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1323) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1323) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_705478.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1323 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1323 /gene="RVS167" /locus_tag="CAALFM_C604040CA" /db_xref="GeneID:3647831" CDS 1..1323 /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="SH3-domain- and BAR domain-containing protein involved in endocytosis; null mutant exhibits defects in hyphal growth, virulence, cell wall integrity, and actin patch localization; cosediments with phosphorylated Myo5p" /codon_start=1 /transl_table=12 /product="amphiphysin" /protein_id="XP_710570.2" /db_xref="CGD:CAL0000200028" /db_xref="GeneID:3647831" /translation="MSFKGFKKGVLRAPQTMRQKFNMGEITQDAVYLDAERRFKEIEM ETKKLSEESKKYFNAVNGMLDEQIDFAKAVAEIYKPISGRLSDPSATVPEDNPQGIEA SESYQAVVKDLKDTLKPDLELIEKRIVEPAQELLKIIQAIRKMSVKRDHKQLDLDRHK RNLSKYESKKERTVKDEEKMFSAQAEVEIAQQEYDYYNDLLKNELPVLFQMQSDFIKP LFVSFYYMQLNIFYTLYTRMEELKIPYFDLSTDIVEAYTAKKGNIEEQTDAIGITHFK VGHAKSKLEATKRRHAAMNSPPPTGASSIASTGTGGELPAYSPGGYNQPYGDSKYQPP SSPATYQSPVVAATAQSPATYQSPVATGQPPSYLPQTPASAPPPQVGSGLPTCTALYD YTAQAQGDLTFPAGAVIEIIQRTEDANGWWTGKYNGQTGVFPGNYVQL" misc_feature 85..735 /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins; Region: BAR_Rvs167p; cd07599" /db_xref="CDD:153283" misc_feature order(112..114,121..126,136..138,142..147,154..159, 163..168,196..201,205..210,217..222,226..231,238..240, 316..318,325..330,616..618,625..630,634..636,649..651, 658..663,667..672,679..684,691..696,700..705,712..717, 721..726) /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:153283" misc_feature <877..1155 /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="large tegument protein UL36; Provisional; Region: PHA03247" /db_xref="CDD:223021" misc_feature 1162..1317 /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="Src Homology 3 domain superfamily; Region: SH3; cl17036" /db_xref="CDD:473055" misc_feature order(1171..1173,1177..1179,1186..1188,1198..1200, 1258..1263,1300..1302,1306..1311) /gene="RVS167" /locus_tag="CAALFM_C604040CA" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212690" ORIGIN 1 atgtcattta aaggattcaa aaagggtgtc cttagggccc cacagacaat gcgtcagaaa 61 ttcaacatgg gagaaatcac ccaagatgct gtttatctcg atgctgaaag aagattcaaa 121 gaaatcgaaa tggaaacaaa aaagttgagt gaagaatcca agaaatattt caatgctgtc 181 aatgggatgt tagatgaaca aattgatttt gccaaagccg tggctgagat ttataaacca 241 atcagtggta gattatcgga ccccagtgct acggtgccag aagataaccc acaaggtatt 301 gaagcatcgg aactgtacca agcagtggtt aaagatctca aagatacctt aaaacccgat 361 ttggaattga ttgaaaaaag aattgttgaa ccagcacaag aattattgaa gattatacaa 421 gctataagga aaatgtcagt gaaaagagac cataaacaat tggatttgga tcgtcataag 481 agaaatcttt ctaaatatga actgaagaaa gaaagaactg ttaaagatga agaaaaaatg 541 ttcagtgctc aagcagaagt agaaattgct caacaagagt acgattatta taatgatttg 601 ttaaagaatg aattgccagt tttgtttcaa atgcaaagtg attttatcaa accattgttt 661 gtttcattct attacatgca gttgaatatt ttctacacat tatacactag aatggaagag 721 ttgaaaattc catattttga tttgtctact gatattgtcg aagcttatac tgccaagaag 781 gggaacattg aggaacaaac cgatgctatt ggaatcactc atttcaaagt cgggcatgcc 841 aaatccaaat tggaagccac taaaagaaga catgctgcta tgaatagtcc acctcctacc 901 ggtgccagct ctattgcatc tacaggtact ggtggtgaat tacctgcata ctccccagga 961 ggttacaacc aaccatatgg tgatagcaag tatcaaccac catcttctcc agcaacatac 1021 caatctccag tagtagcagc cactgctcaa tctccagcta cttatcaatc gccagtggct 1081 actggacaac ctccatcata tttaccacaa actccagcca gtgctccacc accacaagtt 1141 ggtagtggcc ttccaacatg cacggcttta tacgattata ctgcacaagc ccagggtgac 1201 ttgactttcc ctgcaggagc tgttattgaa attatacaaa gaaccgaaga tgccaacgga 1261 tggtggactg gtaaatacaa tggtcaaacc ggtgtgttcc ctggtaatta tgtgcaatta 1321 tag