Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 amphiphysin (RVS167), partial mRNA.


LOCUS       XM_705478               1323 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_705478
VERSION     XM_705478.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1323)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1323)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1323)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1323)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1323)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1323)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_705478.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1323
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1323
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /db_xref="GeneID:3647831"
     CDS             1..1323
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="SH3-domain- and BAR domain-containing protein
                     involved in endocytosis; null mutant exhibits defects in
                     hyphal growth, virulence, cell wall integrity, and actin
                     patch localization; cosediments with phosphorylated Myo5p"
                     /codon_start=1
                     /transl_table=12
                     /product="amphiphysin"
                     /protein_id="XP_710570.2"
                     /db_xref="CGD:CAL0000200028"
                     /db_xref="GeneID:3647831"
                     /translation="MSFKGFKKGVLRAPQTMRQKFNMGEITQDAVYLDAERRFKEIEM
                     ETKKLSEESKKYFNAVNGMLDEQIDFAKAVAEIYKPISGRLSDPSATVPEDNPQGIEA
                     SESYQAVVKDLKDTLKPDLELIEKRIVEPAQELLKIIQAIRKMSVKRDHKQLDLDRHK
                     RNLSKYESKKERTVKDEEKMFSAQAEVEIAQQEYDYYNDLLKNELPVLFQMQSDFIKP
                     LFVSFYYMQLNIFYTLYTRMEELKIPYFDLSTDIVEAYTAKKGNIEEQTDAIGITHFK
                     VGHAKSKLEATKRRHAAMNSPPPTGASSIASTGTGGELPAYSPGGYNQPYGDSKYQPP
                     SSPATYQSPVVAATAQSPATYQSPVATGQPPSYLPQTPASAPPPQVGSGLPTCTALYD
                     YTAQAQGDLTFPAGAVIEIIQRTEDANGWWTGKYNGQTGVFPGNYVQL"
     misc_feature    85..735
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="The Bin/Amphiphysin/Rvs (BAR) domain of
                     Saccharomyces cerevisiae Reduced viability upon starvation
                     protein 167 and similar proteins; Region: BAR_Rvs167p;
                     cd07599"
                     /db_xref="CDD:153283"
     misc_feature    order(112..114,121..126,136..138,142..147,154..159,
                     163..168,196..201,205..210,217..222,226..231,238..240,
                     316..318,325..330,616..618,625..630,634..636,649..651,
                     658..663,667..672,679..684,691..696,700..705,712..717,
                     721..726)
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153283"
     misc_feature    <877..1155
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    1162..1317
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="Src Homology 3 domain superfamily; Region: SH3;
                     cl17036"
                     /db_xref="CDD:473055"
     misc_feature    order(1171..1173,1177..1179,1186..1188,1198..1200,
                     1258..1263,1300..1302,1306..1311)
                     /gene="RVS167"
                     /locus_tag="CAALFM_C604040CA"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212690"
ORIGIN      
        1 atgtcattta aaggattcaa aaagggtgtc cttagggccc cacagacaat gcgtcagaaa
       61 ttcaacatgg gagaaatcac ccaagatgct gtttatctcg atgctgaaag aagattcaaa
      121 gaaatcgaaa tggaaacaaa aaagttgagt gaagaatcca agaaatattt caatgctgtc
      181 aatgggatgt tagatgaaca aattgatttt gccaaagccg tggctgagat ttataaacca
      241 atcagtggta gattatcgga ccccagtgct acggtgccag aagataaccc acaaggtatt
      301 gaagcatcgg aactgtacca agcagtggtt aaagatctca aagatacctt aaaacccgat
      361 ttggaattga ttgaaaaaag aattgttgaa ccagcacaag aattattgaa gattatacaa
      421 gctataagga aaatgtcagt gaaaagagac cataaacaat tggatttgga tcgtcataag
      481 agaaatcttt ctaaatatga actgaagaaa gaaagaactg ttaaagatga agaaaaaatg
      541 ttcagtgctc aagcagaagt agaaattgct caacaagagt acgattatta taatgatttg
      601 ttaaagaatg aattgccagt tttgtttcaa atgcaaagtg attttatcaa accattgttt
      661 gtttcattct attacatgca gttgaatatt ttctacacat tatacactag aatggaagag
      721 ttgaaaattc catattttga tttgtctact gatattgtcg aagcttatac tgccaagaag
      781 gggaacattg aggaacaaac cgatgctatt ggaatcactc atttcaaagt cgggcatgcc
      841 aaatccaaat tggaagccac taaaagaaga catgctgcta tgaatagtcc acctcctacc
      901 ggtgccagct ctattgcatc tacaggtact ggtggtgaat tacctgcata ctccccagga
      961 ggttacaacc aaccatatgg tgatagcaag tatcaaccac catcttctcc agcaacatac
     1021 caatctccag tagtagcagc cactgctcaa tctccagcta cttatcaatc gccagtggct
     1081 actggacaac ctccatcata tttaccacaa actccagcca gtgctccacc accacaagtt
     1141 ggtagtggcc ttccaacatg cacggcttta tacgattata ctgcacaagc ccagggtgac
     1201 ttgactttcc ctgcaggagc tgttattgaa attatacaaa gaaccgaaga tgccaacgga
     1261 tggtggactg gtaaatacaa tggtcaaacc ggtgtgttcc ctggtaatta tgtgcaatta
     1321 tag