Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705469 1533 bp mRNA linear PLN 18-APR-2022 (CAALFM_C604110WA), partial mRNA. ACCESSION XM_705469 VERSION XM_705469.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1533) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1533) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1533) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1533) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1533) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1533) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_705469.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1533 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1533 /locus_tag="CAALFM_C604110WA" /db_xref="GeneID:3647834" CDS 1..1533 /locus_tag="CAALFM_C604110WA" /note="Ortholog(s) have L-arginine transmembrane transporter activity, L-aspartate transmembrane transporter activity and L-glutamate transmembrane transporter activity, more" /codon_start=1 /transl_table=12 /product="aspartate/glutamate transporter" /protein_id="XP_710561.2" /db_xref="CGD:CAL0000175251" /db_xref="GeneID:3647834" /translation="MGRATIKSGSINLLNTIIGAGILAMPYGLKNNGLLFGCILIIWS SLTSSMGLYLQNKVAKYTGQRGSVSYFSLSQLTYPNLSILFDSAISIKCFGVGVSYLV VIGDLMPKIVESLVGGGNINSDSLLMARNFWITIFMIVIVTPLSYLKKLDSLKYTSIL ALFSVGYLICLVVAHYFTTPTTSPSGGGGGDDDDIVYHYIGPISLKSTLSSFPIFVFA YTCHQNMFAIINELKPSDTDGSQTRQSNLIIRNAISIACLSYLIVGIFGYLTFGNSVN ANIITMYPHNSISSLIGRLCIVVMVSLSFPLQCHPCRGSINHVIHFCTHGVQQSKFRS TTTTNNNNNGDQHGYTSLSSDIESLQSIGGNDTTAGSIGSIGGGDSVVGDADESFIST TPVEGAQDTDGHDPIIVPMTTKKFYIITTVIVVLSYLVAISVTSLAHVLAFVGSTGST SISFILPGLFGYLLIKPIEGNTSLNNLEKFCKYGGLFLAIWGILVMIVCLSATIFLGA TH" misc_feature 4..1494 /locus_tag="CAALFM_C604110WA" /note="Solute carrier families 5 and 6-like; solute binding domain; Region: SLC5-6-like_sbd; cl00456" /db_xref="CDD:444915" ORIGIN 1 atgggacgtg ctacgataaa atctggatca atcaatttat taaacaccat aattggtgct 61 ggtatacttg ccatgccata tggattgaaa aataatggat tattatttgg ttgtatatta 121 attatatggt catcattaac ttcatcaatg ggactttatt tacaaaataa agtggctaaa 181 tatactggtc aacgaggttc agtatcatat tttagtttat cacaattgac atatccaaat 241 ttaagtatat tatttgatag tgctattctg attaaatgtt ttggggttgg agttagttat 301 cttgttgtta ttggtgattt aatgcccaaa attgttgaaa gtcttgttgg tggtggtaat 361 attaacctgg attcattatt aatggcacgt aatttttgga tcactatatt tatgattgtt 421 attgttactc ctttatcata tttgaaaaaa ttggattctt tgaaatatac tagtatattg 481 gcattatttt ctgttggtta tttaatttgt cttgttgttg cccattattt tacaaccccc 541 accacatcac catcaggagg aggaggagga gacgacgacg acatagttta tcattatatt 601 ggaccaatat ctttaaagtc aacattaagt tcattcccaa tatttgtttt cgcttatact 661 tgtcatcaaa atatgtttgc cataataaat gaattaaaac caagtgatac cgatggttca 721 caaactagac aatcaaattt aatcattcgt aatgcaatct caattgcttg tttatcttat 781 ttaatcgttg gtatatttgg ttatttaaca tttggtaatt ccgtaaatgc caatattatc 841 actatgtatc ctcataattc aatttcttca ttgattggaa gattatgtat tgtggttatg 901 gtaagtttat cattcccttt acaatgtcat ccttgtcgtg gttcaattaa tcatgtgata 961 catttttgca cccatggagt acaacaatcc aagtttagat ccaccaccac caccaacaac 1021 aacaacaatg gcgatcaaca tggatatact tctttgagtt ctgatattga aagtttacaa 1081 agtattggtg gtaatgatac aactgcgggt agtattggta gtattggtgg tggtgatagt 1141 gttgttggtg atgctgatga atcatttata tctactaccc cagtagaagg agctcaagat 1201 actgatggtc atgatccaat cattgtcccc atgaccacga aaaaatttta tataatcacc 1261 actgtgattg tagtattatc ttatcttgtg gcaatttctg tgacttcatt agctcatgtt 1321 ttggcatttg ttggttccac tggttcaaca tcaatttcat ttatattacc tgggttattt 1381 ggatatttat taattaaacc tatcgaaggt aatacttcat taaataattt agaaaaattt 1441 tgtaaatatg gtggattatt tttagcaatt tgggggattt tagttatgat cgtttgttta 1501 agtgctacaa tctttttagg tgctactcat taa