Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 aspartate/glutamate transporter


LOCUS       XM_705469               1533 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C604110WA), partial mRNA.
ACCESSION   XM_705469
VERSION     XM_705469.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1533)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1533)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1533)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1533)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1533)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1533)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_705469.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1533
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1533
                     /locus_tag="CAALFM_C604110WA"
                     /db_xref="GeneID:3647834"
     CDS             1..1533
                     /locus_tag="CAALFM_C604110WA"
                     /note="Ortholog(s) have L-arginine transmembrane
                     transporter activity, L-aspartate transmembrane
                     transporter activity and L-glutamate transmembrane
                     transporter activity, more"
                     /codon_start=1
                     /transl_table=12
                     /product="aspartate/glutamate transporter"
                     /protein_id="XP_710561.2"
                     /db_xref="CGD:CAL0000175251"
                     /db_xref="GeneID:3647834"
                     /translation="MGRATIKSGSINLLNTIIGAGILAMPYGLKNNGLLFGCILIIWS
                     SLTSSMGLYLQNKVAKYTGQRGSVSYFSLSQLTYPNLSILFDSAISIKCFGVGVSYLV
                     VIGDLMPKIVESLVGGGNINSDSLLMARNFWITIFMIVIVTPLSYLKKLDSLKYTSIL
                     ALFSVGYLICLVVAHYFTTPTTSPSGGGGGDDDDIVYHYIGPISLKSTLSSFPIFVFA
                     YTCHQNMFAIINELKPSDTDGSQTRQSNLIIRNAISIACLSYLIVGIFGYLTFGNSVN
                     ANIITMYPHNSISSLIGRLCIVVMVSLSFPLQCHPCRGSINHVIHFCTHGVQQSKFRS
                     TTTTNNNNNGDQHGYTSLSSDIESLQSIGGNDTTAGSIGSIGGGDSVVGDADESFIST
                     TPVEGAQDTDGHDPIIVPMTTKKFYIITTVIVVLSYLVAISVTSLAHVLAFVGSTGST
                     SISFILPGLFGYLLIKPIEGNTSLNNLEKFCKYGGLFLAIWGILVMIVCLSATIFLGA
                     TH"
     misc_feature    4..1494
                     /locus_tag="CAALFM_C604110WA"
                     /note="Solute carrier families 5 and 6-like; solute
                     binding domain; Region: SLC5-6-like_sbd; cl00456"
                     /db_xref="CDD:444915"
ORIGIN      
        1 atgggacgtg ctacgataaa atctggatca atcaatttat taaacaccat aattggtgct
       61 ggtatacttg ccatgccata tggattgaaa aataatggat tattatttgg ttgtatatta
      121 attatatggt catcattaac ttcatcaatg ggactttatt tacaaaataa agtggctaaa
      181 tatactggtc aacgaggttc agtatcatat tttagtttat cacaattgac atatccaaat
      241 ttaagtatat tatttgatag tgctattctg attaaatgtt ttggggttgg agttagttat
      301 cttgttgtta ttggtgattt aatgcccaaa attgttgaaa gtcttgttgg tggtggtaat
      361 attaacctgg attcattatt aatggcacgt aatttttgga tcactatatt tatgattgtt
      421 attgttactc ctttatcata tttgaaaaaa ttggattctt tgaaatatac tagtatattg
      481 gcattatttt ctgttggtta tttaatttgt cttgttgttg cccattattt tacaaccccc
      541 accacatcac catcaggagg aggaggagga gacgacgacg acatagttta tcattatatt
      601 ggaccaatat ctttaaagtc aacattaagt tcattcccaa tatttgtttt cgcttatact
      661 tgtcatcaaa atatgtttgc cataataaat gaattaaaac caagtgatac cgatggttca
      721 caaactagac aatcaaattt aatcattcgt aatgcaatct caattgcttg tttatcttat
      781 ttaatcgttg gtatatttgg ttatttaaca tttggtaatt ccgtaaatgc caatattatc
      841 actatgtatc ctcataattc aatttcttca ttgattggaa gattatgtat tgtggttatg
      901 gtaagtttat cattcccttt acaatgtcat ccttgtcgtg gttcaattaa tcatgtgata
      961 catttttgca cccatggagt acaacaatcc aagtttagat ccaccaccac caccaacaac
     1021 aacaacaatg gcgatcaaca tggatatact tctttgagtt ctgatattga aagtttacaa
     1081 agtattggtg gtaatgatac aactgcgggt agtattggta gtattggtgg tggtgatagt
     1141 gttgttggtg atgctgatga atcatttata tctactaccc cagtagaagg agctcaagat
     1201 actgatggtc atgatccaat cattgtcccc atgaccacga aaaaatttta tataatcacc
     1261 actgtgattg tagtattatc ttatcttgtg gcaatttctg tgacttcatt agctcatgtt
     1321 ttggcatttg ttggttccac tggttcaaca tcaatttcat ttatattacc tgggttattt
     1381 ggatatttat taattaaacc tatcgaaggt aatacttcat taaataattt agaaaaattt
     1441 tgtaaatatg gtggattatt tttagcaatt tgggggattt tagttatgat cgtttgttta
     1501 agtgctacaa tctttttagg tgctactcat taa