Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705413 525 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_705413 VERSION XM_705413.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 525) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 525) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 525) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 525) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 525) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 525) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_705413.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..525 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>525 /gene="TLO13" /locus_tag="CAALFM_C600030WA" /db_xref="GeneID:3647891" CDS 1..525 /gene="TLO13" /locus_tag="CAALFM_C600030WA" /note="Member of a family of telomere-proximal genes of unknown function; may be spliced in vivo; overlaps orf19.6337.1, which is a region annotated as blocked reading frame" /codon_start=1 /transl_table=12 /product="Tlo13p" /protein_id="XP_710505.2" /db_xref="CGD:CAL0000176226" /db_xref="GeneID:3647891" /translation="MPENLQTRLHNSLDEILKSSGYIFEIIDQNRKQSNVITSPNNEL IQKSITQSLNGEIQNFHAILDQTVSKLDDAEWCLGVMVEKKKKLDELKVKEEAARKKE EEAKKEEEXKKAEEAKKCFILLFCQICTTFNLCANILFYLIFIYFYFTILFYRTFYIF SLSTHLLYNIFLRL" misc_feature 10..>246 /gene="TLO13" /locus_tag="CAALFM_C600030WA" /note="Mediator complex subunit 2; Region: Med2; pfam11214" /db_xref="CDD:402683" ORIGIN 1 atgccagaaa acctccaaac aagattacat aactcactcg acgagatatt gaaatcatca 61 ggatacatat ttgagataat cgaccaaaac agaaaacaaa gcaatgtgat tactagcccc 121 aacaacgaac taatccaaaa atccataacc caactgctca acggcgaaat ccaaaacttc 181 catgctattc tagaccaaac agtgtcgaaa ctcgatgatg cagagtggtg tctcggcgtt 241 atggttgaaa agaaaaagaa acttgacgaa ttgaaagtca aagaagaagc ggcaagaaag 301 aaggaagaag aggccaagaa ggaagaagag gycaagaaag cagaggaagc gaagaagtgt 361 tttattttac ttttctgtca aatttgcact acttttaatt tgtgtgcaaa tattctattt 421 tacttgattt ttatatactt ttattttaca atactttttt ataggacttt ttatatcttt 481 tctttatcaa ctcatctttt atacaatata ttcttacgat tataa