Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219353 2505 bp mRNA linear INV 09-DEC-2024 transcript variant X3, mRNA. ACCESSION XM_070219353 VERSION XM_070219353.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2505 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2505 /gene="Proc-R" /note="Proctolin receptor; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108068640" CDS 455..2116 /gene="Proc-R" /codon_start=1 /product="uncharacterized protein Proc-R" /protein_id="XP_070075454.1" /db_xref="GeneID:108068640" /translation="MTMSTTSTATLTEAAAAAAAEAATLGNATVGEMFSDADMAEVRH VVQRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQ HYDYPKYNFKIYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTES LAKKVIAAVAIFCLLSTLSTAFEHTITVGWKQIDDAYQPCNQTVANISPTPPPSAAAT PPLVTPPLPTPATIWQSQDLTTESTTAGSSNLLADWGSGSGDGEPDNIPRQRRHWQSS GFVTLPTLRKTLEEQEQDQDVQEGEGELGSRVTESLLQLLRRKRSAQNSNSNNTDAFA FNVTEYCQNVTFYNHGLSELGKDELYSNLWNMFTLLVFVVFPLLLLATFNTFLILLVH RSKNLRGDLTNASSIRRTKRKSNSGIKGSVSQENRVTITLIAVVLMFIVCQLPWAIYL VVNQYMDIQVGTQVVAGNVCNLLASLHAASNFFLYCVLSDKYRKTVRELITGYRYRRR HARNNTSLYVPHTTTTLTQINGDHYGSNYGGAGSRRNRNTNRLIA" misc_feature 587..1942 /gene="Proc-R" /note="FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Region: 7tmA_FMRFamide_R-like; cd14978" /db_xref="CDD:410630" misc_feature 590..670 /gene="Proc-R" /note="TM helix 1 [structural motif]; Region: TM helix 1" /db_xref="CDD:410630" misc_feature 686..763 /gene="Proc-R" /note="TM helix 2 [structural motif]; Region: TM helix 2" /db_xref="CDD:410630" misc_feature order(752..754,761..766,806..823,827..832,839..841, 974..976,980..994,1529..1531,1538..1546,1556..1564, 1568..1573,1778..1780,1787..1792,1796..1801,1808..1810, 1841..1846,1850..1858,1865..1867,1874..1879) /gene="Proc-R" /note="putative ligand binding pocket [chemical binding]; other site" /db_xref="CDD:410630" misc_feature 806..898 /gene="Proc-R" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:410630" misc_feature 932..994 /gene="Proc-R" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:410630" misc_feature 1529..1612 /gene="Proc-R" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:410630" misc_feature 1721..1813 /gene="Proc-R" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:410630" misc_feature 1844..1921 /gene="Proc-R" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:410630" ORIGIN 1 tctcctcgcg atgctctggc gttgatcttc gccgatccga gatcctctct cttccccaat 61 ttcggtgaac tgcaaaaata tggaaaattt taaattgaaa ccccataaaa atatgtgaaa 121 atgtttgaat acattaatta atactcagtg accaagaaca taaaagcatc tgtaattgat 181 ggatttgctg gcatgaccga aatataatta acagcaaaaa caatcggcga aaaaacaaca 241 gtcaacagaa caactttatt attccagagg gcgtggcagt gggcgtttgt gtgttttggc 301 tgctgacaaa agtgcaattg aaatcggaat cggaatcgag tggagacggg gaacatcggg 361 aaaacgcaac cgatacgggc caaactcaag tggccaggat aggcggcgaa aagaaggagt 421 tagcgggtgg ggaggcgtgg cagcggcagc agtcatgaca atgtccacga cgtcgactgc 481 gacgctgact gaggcagcgg cagcggcagc ggcagaggcg gcgacgctgg gaaacgcgac 541 tgttggcgaa atgttttcgg atgcggatat ggcggaagtg cggcatgttg tccaacgcat 601 tttggtgccg tgcgtttttg ttattggact attgggaaat tcagtgagca tttatgtttt 661 gacgcgaaag cgcatgaggt gcaccacgaa catttatcta acggccctgg ccatcacgga 721 tattgcctac ctgacctgtc aattaatcct ctcgctccag cactacgatt atcccaagta 781 caactttaaa atttactggc agctctatgg ctacttcgtc tggctgtgcg acagttttgg 841 ttacatctcg atttacatag ccgtgtgctt caccatcgag cgattcatag cgatacgcta 901 tccgctcaag agacaaacat tctgcacgga atcgctggcc aagaaggtga tagcggccgt 961 ggctatcttt tgtttgctgt ccacgctctc gacggcattc gagcacacaa ttacggtcgg 1021 ctggaagcag attgatgacg cctaccagcc gtgcaaccaa acggtggcca acatctcgcc 1081 cacgcccccg ccctccgcag cggccacgcc cccactggtc acgcccccgc ttcccacgcc 1141 ggcgaccatt tggcaatcgc aggaccttac aacggagtcg accaccgccg gcagctcaaa 1201 tctgctcgcc gactggggca gcggcagcgg tgacggagag ccagacaaca ttccacgaca 1261 acgccgtcac tggcagtcat ctggatttgt gacgcttccc actctgagga aaacgctcga 1321 ggagcaggag caggatcagg acgtgcaaga gggagaggga gagctggggt caagggtcac 1381 tgaaagttta ctgcaattgt tgcgtcgcaa acgcagcgct caaaacagca acagcaacaa 1441 tacggatgca ttcgcattta atgtaacaga atactgtcaa aatgtgactt tttataatca 1501 tggtctttcg gaactgggca aagatgagct gtatagtaat ctgtggaaca tgtttacact 1561 gctggttttc gtagtgtttc ccctactttt attggccacc tttaacacct ttctcattct 1621 tctggtgcat cgatcaaaga atctgcgtgg ggatctgacc aatgcgagca gcataaggcg 1681 cacaaaacgg aagtcaaatt ctggaattaa aggcagcgtt tcgcaggaga accgagtgac 1741 gatcacatta attgccgtgg tgcttatgtt catagtttgt caactgccgt gggcgattta 1801 cttggtggtg aatcagtata tggacattca agttggaact caggtggtgg cgggaaatgt 1861 ttgcaaccta ttggcctccc ttcatgcggc ctcgaatttt ttcttatact gcgtgctgtc 1921 cgataaatat cgaaagacgg tacgtgaact aattaccgga tatcgctata gacgtcgaca 1981 tgcccggaat aataccagcc tatatgtgcc ccatacgacg actacactga cccaaataaa 2041 tggggaccac tatggtagta attatggcgg agccggaagt cgccgaaatc gcaatacaaa 2101 tcgcctgata gcgtgaataa tcgcgaatat ttatataaat tgtatactgg ttgaactcca 2161 tgagtagagt taatctccct tttgtgagat tctcggcaga aaaaaggctt taaatttgcc 2221 agcaaatcat tacggaatca caagtgactc gtttaaatca aaagtgattc tatctaagcg 2281 tgtgatttgc agaaaattta atttgttata tcaatcgata tctatgtata tctctatctc 2341 tctctatata tatatatata ttacataaca tacattgtgc cataatgtga tgattataga 2401 tttatgctag ttaacctaaa cgtaattgtt gtcctaagta ctaaacgcat caaatcaaat 2461 acacgcaaaa tacacacaca aataaacaaa ggcccattgg agagt