Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Proctolin receptor (Proc-R),


LOCUS       XM_070219353            2505 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X3, mRNA.
ACCESSION   XM_070219353
VERSION     XM_070219353.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2505
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2505
                     /gene="Proc-R"
                     /note="Proctolin receptor; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:108068640"
     CDS             455..2116
                     /gene="Proc-R"
                     /codon_start=1
                     /product="uncharacterized protein Proc-R"
                     /protein_id="XP_070075454.1"
                     /db_xref="GeneID:108068640"
                     /translation="MTMSTTSTATLTEAAAAAAAEAATLGNATVGEMFSDADMAEVRH
                     VVQRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQ
                     HYDYPKYNFKIYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTES
                     LAKKVIAAVAIFCLLSTLSTAFEHTITVGWKQIDDAYQPCNQTVANISPTPPPSAAAT
                     PPLVTPPLPTPATIWQSQDLTTESTTAGSSNLLADWGSGSGDGEPDNIPRQRRHWQSS
                     GFVTLPTLRKTLEEQEQDQDVQEGEGELGSRVTESLLQLLRRKRSAQNSNSNNTDAFA
                     FNVTEYCQNVTFYNHGLSELGKDELYSNLWNMFTLLVFVVFPLLLLATFNTFLILLVH
                     RSKNLRGDLTNASSIRRTKRKSNSGIKGSVSQENRVTITLIAVVLMFIVCQLPWAIYL
                     VVNQYMDIQVGTQVVAGNVCNLLASLHAASNFFLYCVLSDKYRKTVRELITGYRYRRR
                     HARNNTSLYVPHTTTTLTQINGDHYGSNYGGAGSRRNRNTNRLIA"
     misc_feature    587..1942
                     /gene="Proc-R"
                     /note="FMRFamide (Phe-Met-Arg-Phe) receptors and related
                     proteins, member of the class A family of
                     seven-transmembrane G protein-coupled receptors; Region:
                     7tmA_FMRFamide_R-like; cd14978"
                     /db_xref="CDD:410630"
     misc_feature    590..670
                     /gene="Proc-R"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410630"
     misc_feature    686..763
                     /gene="Proc-R"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:410630"
     misc_feature    order(752..754,761..766,806..823,827..832,839..841,
                     974..976,980..994,1529..1531,1538..1546,1556..1564,
                     1568..1573,1778..1780,1787..1792,1796..1801,1808..1810,
                     1841..1846,1850..1858,1865..1867,1874..1879)
                     /gene="Proc-R"
                     /note="putative ligand binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:410630"
     misc_feature    806..898
                     /gene="Proc-R"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410630"
     misc_feature    932..994
                     /gene="Proc-R"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410630"
     misc_feature    1529..1612
                     /gene="Proc-R"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410630"
     misc_feature    1721..1813
                     /gene="Proc-R"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:410630"
     misc_feature    1844..1921
                     /gene="Proc-R"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:410630"
ORIGIN      
        1 tctcctcgcg atgctctggc gttgatcttc gccgatccga gatcctctct cttccccaat
       61 ttcggtgaac tgcaaaaata tggaaaattt taaattgaaa ccccataaaa atatgtgaaa
      121 atgtttgaat acattaatta atactcagtg accaagaaca taaaagcatc tgtaattgat
      181 ggatttgctg gcatgaccga aatataatta acagcaaaaa caatcggcga aaaaacaaca
      241 gtcaacagaa caactttatt attccagagg gcgtggcagt gggcgtttgt gtgttttggc
      301 tgctgacaaa agtgcaattg aaatcggaat cggaatcgag tggagacggg gaacatcggg
      361 aaaacgcaac cgatacgggc caaactcaag tggccaggat aggcggcgaa aagaaggagt
      421 tagcgggtgg ggaggcgtgg cagcggcagc agtcatgaca atgtccacga cgtcgactgc
      481 gacgctgact gaggcagcgg cagcggcagc ggcagaggcg gcgacgctgg gaaacgcgac
      541 tgttggcgaa atgttttcgg atgcggatat ggcggaagtg cggcatgttg tccaacgcat
      601 tttggtgccg tgcgtttttg ttattggact attgggaaat tcagtgagca tttatgtttt
      661 gacgcgaaag cgcatgaggt gcaccacgaa catttatcta acggccctgg ccatcacgga
      721 tattgcctac ctgacctgtc aattaatcct ctcgctccag cactacgatt atcccaagta
      781 caactttaaa atttactggc agctctatgg ctacttcgtc tggctgtgcg acagttttgg
      841 ttacatctcg atttacatag ccgtgtgctt caccatcgag cgattcatag cgatacgcta
      901 tccgctcaag agacaaacat tctgcacgga atcgctggcc aagaaggtga tagcggccgt
      961 ggctatcttt tgtttgctgt ccacgctctc gacggcattc gagcacacaa ttacggtcgg
     1021 ctggaagcag attgatgacg cctaccagcc gtgcaaccaa acggtggcca acatctcgcc
     1081 cacgcccccg ccctccgcag cggccacgcc cccactggtc acgcccccgc ttcccacgcc
     1141 ggcgaccatt tggcaatcgc aggaccttac aacggagtcg accaccgccg gcagctcaaa
     1201 tctgctcgcc gactggggca gcggcagcgg tgacggagag ccagacaaca ttccacgaca
     1261 acgccgtcac tggcagtcat ctggatttgt gacgcttccc actctgagga aaacgctcga
     1321 ggagcaggag caggatcagg acgtgcaaga gggagaggga gagctggggt caagggtcac
     1381 tgaaagttta ctgcaattgt tgcgtcgcaa acgcagcgct caaaacagca acagcaacaa
     1441 tacggatgca ttcgcattta atgtaacaga atactgtcaa aatgtgactt tttataatca
     1501 tggtctttcg gaactgggca aagatgagct gtatagtaat ctgtggaaca tgtttacact
     1561 gctggttttc gtagtgtttc ccctactttt attggccacc tttaacacct ttctcattct
     1621 tctggtgcat cgatcaaaga atctgcgtgg ggatctgacc aatgcgagca gcataaggcg
     1681 cacaaaacgg aagtcaaatt ctggaattaa aggcagcgtt tcgcaggaga accgagtgac
     1741 gatcacatta attgccgtgg tgcttatgtt catagtttgt caactgccgt gggcgattta
     1801 cttggtggtg aatcagtata tggacattca agttggaact caggtggtgg cgggaaatgt
     1861 ttgcaaccta ttggcctccc ttcatgcggc ctcgaatttt ttcttatact gcgtgctgtc
     1921 cgataaatat cgaaagacgg tacgtgaact aattaccgga tatcgctata gacgtcgaca
     1981 tgcccggaat aataccagcc tatatgtgcc ccatacgacg actacactga cccaaataaa
     2041 tggggaccac tatggtagta attatggcgg agccggaagt cgccgaaatc gcaatacaaa
     2101 tcgcctgata gcgtgaataa tcgcgaatat ttatataaat tgtatactgg ttgaactcca
     2161 tgagtagagt taatctccct tttgtgagat tctcggcaga aaaaaggctt taaatttgcc
     2221 agcaaatcat tacggaatca caagtgactc gtttaaatca aaagtgattc tatctaagcg
     2281 tgtgatttgc agaaaattta atttgttata tcaatcgata tctatgtata tctctatctc
     2341 tctctatata tatatatata ttacataaca tacattgtgc cataatgtga tgattataga
     2401 tttatgctag ttaacctaaa cgtaattgtt gtcctaagta ctaaacgcat caaatcaaat
     2461 acacgcaaaa tacacacaca aataaacaaa ggcccattgg agagt