Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219321 8812 bp mRNA linear INV 09-DEC-2024 (sdk), transcript variant X6, mRNA. ACCESSION XM_070219321 VERSION XM_070219321.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..8812 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..8812 /gene="sdk" /note="sidekick cell adhesion molecule; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108055805" CDS 378..7208 /gene="sdk" /codon_start=1 /product="protein sidekick isoform X4" /protein_id="XP_070075422.1" /db_xref="GeneID:108055805" /translation="MLKSAASSLRRRRPKTTATTAIEMPSLPQSASLLAALLVLCYCD SCSFFCYADANPQPQQQNQNQLVQQQQLQAPRFTTHPSASGSIVSEGSTKILQCHALG YPQPTYRWLKDGVPVGDFSSSQFYRFHSTRREDAGSYQCIARNDAGSIFSEKSDVVVA YMGIFENTTEGRLTVISGHPAIFDMPAIESVPVPSVTWQSEDGPLSYDIKYAFTQANQ LVILSADENDRKGYRAKATNTQLGKEESSPYVHLNVSGDPYIEVAPEIIVPPQDVKVK MGTGVVELQCIANARPLHELETIWLKDGIAVETAGVRHTLSDPWNRTLALLQANSSHS GEYTCQVRLRSGGYPAVSASAHLQILEPPVFFTPMRAETFGEFGGQVQLACDVVGEPT PQVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTW LRVKTKTAKIRVKRLAQPRILRVRASHAGLGSEKGSGSGSGSGSSGRRKEFRFASAPI MELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGDLLISN IRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSD PSVPYNIDWYREGQSATPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNET RAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELE KFVGPVPDPLLNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSN VVELPQEAPSGPPVGFVGSARSMSEIISQWQPPLEEHRNGQILGYILRYRLFGYNNVP WSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPT NVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWKDIERRMKTVPPS LIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASIQVPVMTQDDVPDEITALHFD DVSDRSVKVLWSPPRYSNGILTGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATT HYWFEIFAWTRVGSGTPKTATIQSGVEPVLPHAPTSLALSNIEAFSVVLQFTPGFDGN SSITKWKVEGQTARNMTWFTICEINDPDAETLTVTGLVPFTQYRMRLSASNVVGSSKP SEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQVV KAPGTVKYLPRSVVIEDHTANSHVLDGLEEWTLYEVKMNACNDVGCSKESETAVERTR EAVPSYGPLDVQANATTSTTVVVQWGEVPPQHRNGQIDGYKVFYAATDREQKVLHKTI PNNATFTTTLTELKKFVVYHVQVLAYTRLGNGALSTPPIRVQTFEDTPGVPSNVSFPD VTLTMARIIWDVPMDPNGEILAYQVTYTLNGSAMLNYSREFPPSDRTFRATGLLPEKY YSFSCTAQTRLGWGKIATALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDG FAPLRYYTVEMRENEGRWQPLPERVDPLLSSYTALGLRPYMTYQFRIQATNDLGPSAF SRESVVVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETGMWNGDAGTGGYRILYQQ LSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYV GEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGR KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAP LHLRFSDITMQSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQVKQKVSNTTLRV QNLEEEVTYTFTVRAQTSVDYGPGVSENVTTGPQDGSPVAPRDLILTKTLSSVEMHWI NGPSGRGPILGYLIEAKKREKGEPSFVYDSRWTKIEQTRKGMMQDFTVSYHILMPSTA YTFRVIAYNRYGISFPVYSKDSILTPSKLHLEYGYLQHKPFYRQTWFMVSLAATSIVI IVMVIAVLCVKSKSYKYKQEAQKTLEESMAMSIDERQELALELYRSRHGVGTGTLNSV GTLRSGTLGTLGRKSTNRPPPGVHLGKSPPRPSPASVAYHSDEESLKCYDENPDDSSV TEKPSEHSESENESVRSDPHSFVNHYANVNDSLRQSWKKTKPVRNYSSYTDSEPEGSA VMSLNGGQIIVNNMARSRAPLPGFSSFV" misc_feature 600..812 /gene="sdk" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 891..1139 /gene="sdk" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1167..1454 /gene="sdk" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1221..1235 /gene="sdk" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1266..1280 /gene="sdk" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1341..1355 /gene="sdk" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1383..1400 /gene="sdk" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1464..1739 /gene="sdk" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1518..1532 /gene="sdk" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1557..1571 /gene="sdk" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1632..1646 /gene="sdk" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1674..1691 /gene="sdk" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1713..1724 /gene="sdk" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1902..2159 /gene="sdk" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1947..1961 /gene="sdk" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1986..2000 /gene="sdk" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2058..2069 /gene="sdk" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2097..2114 /gene="sdk" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2136..2147 /gene="sdk" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2172..2444 /gene="sdk" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2220..2234 /gene="sdk" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2265..2279 /gene="sdk" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2340..2354 /gene="sdk" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2382..2399 /gene="sdk" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2421..2432 /gene="sdk" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2454..2777 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2454..2456,2697..2699,2742..2744) /gene="sdk" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(2745..2750,2754..2759) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2802..3089 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(3054..3059,3063..3068) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3111..3425 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature <3288..4541 /gene="sdk" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(3390..3395,3399..3404) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 4653..4931 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(4653..4655,4848..4850,4893..4895) /gene="sdk" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(4896..4901,4905..4910) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 4986..>6257 /gene="sdk" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature 5892..6170 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(5892..5894,6090..6092,6135..6137) /gene="sdk" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(6138..6143,6144..6149) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 6189..6482 /gene="sdk" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(6189..6191,6414..6416,6459..6461) /gene="sdk" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(6462..6467,6471..6476) /gene="sdk" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" polyA_site 8812 /gene="sdk" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagcgcagtt tgttttgtgc gcgcgtggtg aacggttgtt tctcggctgc tcgtcgcgag 61 attgcagttt cttcgatttg cgaattgcga ttgtgcgact tctggactgc cggactccga 121 gttttagttg attgttgtga ttttgagcgt tctggacccg gacaaaacgt aattgttgtt 181 acctttgacg ctctctgggg gcagagacaa gtactacaac aaaaagttat ccagaaagaa 241 gaagaaaagc accaaaaaga tgtgagagat gcataattaa aactagacct tagactaaaa 301 agtagaaaag acgaaggaag acgaaggcgg ccaaaaacat tgaaggaaat ccaagaaata 361 ccaaaagaca acaacaaatg ctcaaatccg cggcgtcgtc gctgcgtcga cgtcgtccaa 421 aaacaacagc aacaacagcc attgagatgc cgtcgctgcc gcagtcggcg tcgctgcttg 481 cagcgctgct cgtgctctgc tactgcgaca gctgctcttt tttttgttac gcggatgcca 541 atccacagcc gcagcagcag aaccagaatc agcttgtcca gcagcagcag ctgcaggccc 601 cacgattcac cacgcatcca tcggcatcgg ggtcgattgt cagcgagggc agcaccaaga 661 tactacagtg tcatgcgctg ggatacccgc agcccacata tcgatggctg aaggacggcg 721 tccccgtggg cgacttctca tccagccagt tctaccgatt ccacagcact cggcgcgagg 781 atgcgggcag ctatcagtgc attgccagga atgatgccgg atccatattc agcgagaaga 841 gcgacgttgt cgttgcctac atgggcatct ttgagaacac caccgagggt cgactgactg 901 tgatcagtgg tcatccggcc atattcgata tgccagccat tgaatctgtg cccgtgccat 961 cggttacgtg gcaatcggag gatggacccc tgagctatga catcaagtac gccttcacgc 1021 aggccaatca gttggttatc ctgagtgcgg atgagaacga tcgcaagggc tatcgggcca 1081 aggcgacaaa tacccagttg ggcaaggagg agagcagccc ctatgtccat ctaaatgtca 1141 gcggagatcc gtatatcgag gtggcacccg agatcatagt gccaccgcag gatgtcaaag 1201 ttaaaatggg aaccggagtg gtggaattgc agtgcattgc gaatgcccga cctctgcatg 1261 aattggaaac tatctggctg aaagatggca ttgccgtgga aacggccggc gtgaggcaca 1321 ctctcagtga tccctggaat cgaactctgg ccctgctgca ggcgaatagc tcgcattcgg 1381 gcgaatatac ctgccaggtg cgattgcgca gtggtggcta tccggccgta agtgcttcgg 1441 ctcatctgca aatcctcgaa ccgcctgtat tctttacacc catgcgagcg gaaacctttg 1501 gcgaattcgg tggacaggtg cagctagcct gcgatgtggt tggcgagccg acgccccagg 1561 tcaagtggtt caggaatgcc gaatcggtgg atgcacatat cgaaagcgga agatacacgt 1621 tgaacacgga taatacgctg gtaattaaga aactaatcct ggatgatgcc gccatgtttc 1681 agtgtttggc catcaacgag gcgggcgaga attcggcgag cacctggctg cgcgtgaaaa 1741 caaaaacggc caagatccgc gtgaagcgtt tggcccagcc gcgaatcctg agggtaagag 1801 cttcgcatgc tggcttggga tcggaaaagg gatcgggatc gggatcggga tcaggttcct 1861 ccggtagacg caaggagttt cgctttgcat cggctccgat tatggagttg ccgccccaga 1921 atgtcaccgc tttggatggc aaggacgcga ctatttcctg ccgggccgta ggatcgccca 1981 atccgaatat aacctggata tataacgaga cccaactggt ggatatatcc agccgggtgc 2041 agatactcga atcgggtgac ctgctcatct cgaacatccg atccgtggac gcgggtctgt 2101 atatctgcgt gcgggccaac gaggcgggca gcgtcaaggg cgaggcctat ttgagtgttt 2161 tggtgcggac acaaatcatc cagccgccgg tggacacaac ggtgctactt ggcctgacgg 2221 ccacgctgca gtgcaaggtg tccagtgatc ccagtgtgcc gtacaacatc gactggtatc 2281 gcgagggtca gtcggcgacg cccatcagta attcgcagcg cattggcgtc caggcggacg 2341 ggcagctgga gatccaggcg gtgcgggcca gcgacgtggg cagttatgcc tgtgtggtca 2401 cctcgcccgg gggaaatgag acgcgggccg ctcgcctcag cgtcatcgaa ctgccgttcc 2461 cgccgagcaa tgtgaaggtg gaacgactgc cggagccgca acagcgcagc atcaacgtgt 2521 cctggacacc gggattcgat ggcaacagtc caatatccaa atttattatc cagcgacgtg 2581 aggtctccga attggaaaaa ttcgtaggtc cagttccaga ccctctgctc aactggatca 2641 ccgaactgag caatgtctcg gcggatcaac gatggatcct gctcgagaac ctcaaggccg 2701 ccaccgtcta tcagtttagg gttagtgccg taaatcgcgt gggcgagggt tcgccatcgg 2761 aacccagtaa tgtggtcgaa ctgccccagg aagctccttc cggtccgccg gtgggcttcg 2821 ttggatccgc tcgctccatg tcggagatca tctcgcagtg gcaaccgcct ctggaggagc 2881 atcgcaacgg ccagatcctt ggctacatac tgcgctatcg cctctttggc tacaacaatg 2941 tgccatggtc ctatcagaat atcaccaacg aagcacagcg caactttctc atccaggagc 3001 tgatcacatg gaaggattac attgtacaga tcgccgccta caacaacatg ggcgtgggcg 3061 tttacaccga gggttcgaag atcaagacca aggagggagt acccgaggca ccgccgacga 3121 atgtgaaagt ggaggcgatc aattcgacgg ccgccagatg ccgatggaca ccccccaatc 3181 cgcagcagat aaatggcatc aatcagggct acaagattca ggcatggcaa agacgattga 3241 tcgatggcga gtggaaggat atcgagagac ggatgaagac ggtgccgccg agtctcatcg 3301 atccactggc cgaacagacg gccattcttg gtggcctgga gaagttcacc gagtacaata 3361 tcagcgtgct gtgcttcacg gatcccggcg atggtgtggc cagtatccaa gtgcccgtga 3421 tgacgcagga tgatgtgccc gacgagatca ccgccttgca tttcgatgat gtctccgatc 3481 gatcggtgaa ggttctctgg tcaccgccac gctattcaaa cggcatttta acaggctaca 3541 cggttcgtta ccaagtcaaa gatcgtccgg ataccctgaa atcatttaac ctgactgctg 3601 atgataccga attgacggtg aatcagctgc aggccaccac acactattgg ttcgagatct 3661 ttgcctggac gcgcgtgggc agtggcactc cgaaaacggc gaccattcaa tcgggcgtgg 3721 agccagtcct tccccacgct cccaccagct tggccctgtc caatatcgag gccttctccg 3781 tggtgctgca atttacgcca ggtttcgatg ggaactcgag cattaccaag tggaaggttg 3841 agggtcagac ggcaaggaat atgacatggt tcaccatttg cgagatcaac gatcccgatg 3901 cagagacttt gactgtcacg ggtctagtgc cattcaccca atatcgaatg agattgagtg 3961 ccagcaatgt ggtgggcagt tcgaaaccct cggaggctac gaaagatttc cagaccattc 4021 aggcgaggcc caaacatccg ccattcaatg tgacggtgag ggcaatgagt gcccagcagc 4081 tgcgagttcg ttggattccg ctgcaacaga ccgagtggta tggcaatccc aggggctata 4141 atatatccta caagcaggtg gtcaaggcac ccggcaccgt aaaatatcta ccacgttcgg 4201 tggtcatcga agatcatacg gccaattcgc atgtgctcga cggcctggag gagtggacgc 4261 tgtacgaggt gaagatgaat gcctgcaacg atgtgggctg ctccaaggag agcgagacgg 4321 cggtggagag gacccgggaa gcggtgccca gctatgggcc actggatgtc caggcgaatg 4381 ccacgacatc gaccacagtg gtggtgcaat ggggcgaagt gccgccgcag cacaggaatg 4441 gccagatcga tgggtacaaa gttttctatg cggcgacgga tcgggagcaa aaggtgctgc 4501 acaagacgat accgaacaat gccacattta ccacaaccct gacggaattg aagaagtttg 4561 tggtctatca cgttcaggtt ttggcctaca cgcgtttggg taatggtgct ttgagtactc 4621 cacccatcag ggttcagacc tttgaggata ccccgggtgt tccgtcgaat gttagctttc 4681 ccgatgtcac tttgaccatg gctcgcatca tctgggatgt gcccatggat ccgaatggcg 4741 agattctggc atatcaggtc acctacaccc tgaatggcag tgccatgttg aactacagtc 4801 gcgagtttcc gccctcggat cgaacattcc gggccaccgg tctgctgccc gagaagtatt 4861 acagttttag ttgcacggcc cagacgcgtt tgggttgggg caagatagcc acggcactgg 4921 tgtacaccac taataatagg gagcgtccgc aggcgccgtc agtgccgcag atatcacgca 4981 gtcagattca ggcgcatcag atcaccttca gttggacacc gggaagggat ggcttcgccc 5041 cactgcgtta ctacaccgtc gagatgcgcg agaacgaggg caggtggcag ccgctgccgg 5101 agcgagtgga tccgctgctg agttcgtaca cagcactcgg attgagaccc tatatgacgt 5161 atcagtttcg catacaggcc accaacgatc tgggaccctc ggcctttagt cgcgaaagtg 5221 tggtggttag aactttgcca gctgctccgg ccgttggagt gggaggttta aaggtggtgc 5281 ccatcaccac gacatcggtg cgagtgcagt ggagtgctct ggagacggga atgtggaatg 5341 gtgatgcggg aaccggtggc tataggattc tgtatcagca actctccgat tttcccaccg 5401 ccctgcagtc gacacccaaa acggatgtgc acgggatcaa tgagaatagt gtggtgctat 5461 cggatcttca gcaggatcga aactatgaga ttgtggtgtt gccgtttaat tcgcagggtc 5521 caggacctgc cacgcccccc gcggcggtgt atgtgggcga ggcggtgccg acgggcgaac 5581 cgcgagccgt ggacgcagct cccatttcca gcaccgaagt gcgtctgctg tggaagccac 5641 cgaagcagag catgcagaat ggcgatattc tgggctataa gatctactat ctggtcacct 5701 attcaccgca ggcactggag cctgggcgca agtgggagga ggaaatcgag gtggtctcgg 5761 ccacggccac ttcgcacagt ctcgtctttc tcgacaagtt caccgagtat cgcatccaat 5821 tgctggcctt taacccagca ggagatggcc caagatcagc cccgattact gtgaagacgc 5881 tgccaggagt gccgagtgct ccgcttcatc tgcgcttctc ggacatcacg atgcagagcc 5941 tggaggtcac ctgggatcca ccgaagttct taaacggcga gattttgggc tacctggtaa 6001 cctacgaaac caccgaggag aatgagaaat ttagcaagca ggtgaagcag aaggtatcca 6061 ataccacact tcgtgtgcag aatctggagg aggaggtaac ctacactttt acggtgcggg 6121 ctcaaacgtc cgtggactac ggaccgggtg tgagtgagaa tgtgacgacg ggaccccaag 6181 atggatcccc cgtggcgcca cgagatctca tcttgaccaa gacgctgtcc agcgtcgaga 6241 tgcactggat caatgggccg tcgggaaggg gacccatttt gggttacctc atagaggcca 6301 agaagcggga aaaaggagag ccgtcatttg tttacgattc ccgctggacg aaaatcgagc 6361 agaccaggaa gggcatgatg caggacttta cggtcagcta tcacatcctg atgccctcga 6421 cggcgtacac attccgggtg attgcataca atcgctatgg catttcgttt cccgtttact 6481 ccaaggactc gatcctgacg ccctcgaaac tgcacctgga atatggctat ctgcagcaca 6541 agccgttcta tcggcaaacc tggtttatgg tctcactggc ggccacctcg attgtgatca 6601 tagtgatggt cattgcggtg ctgtgtgtca agagcaagag ctacaaatat aagcaggagg 6661 cccagaagac gctggaggag tccatggcca tgtccattga cgagcgacag gagttggctt 6721 tggagttgta tcgctctcgt cacggcgttg gaaccggcac actgaacagc gtgggcactc 6781 tgcgcagcgg caccttgggc actctgggca ggaagtccac caatcgaccg ccgccgggcg 6841 tccatctcgg caagagtccg ccacgcccct cgcccgcctc cgtggcctac cacagcgacg 6901 aggagagctt gaagtgctac gacgagaatc cggacgacag cagtgtaacc gagaagccct 6961 cggagcattc ggagagcgaa aacgagagcg tgcgcagtga tccgcattcg tttgtgaatc 7021 actatgccaa cgtcaacgac tcactgcggc agtcgtggaa gaagaccaaa ccggtgcgga 7081 actactccag ctacaccgac tcagagccgg agggcagtgc agtgatgagc ctcaatggtg 7141 gccagattat cgtcaataat atggccagat cgagggcacc actgcccggc ttctcgtcgt 7201 tcgtctgaca atcaaccgag ttctaagatc taagcaccag tagcaacggc accgtcatcc 7261 gcgagacctt tgtctagact tgagggcttc aaaggaggag gaacaaggga tccggagaag 7321 gaagacggag ctgggggctt ggctgggggc gagtcgggac attggagaag gacaccacac 7381 atatcagact ggtccaggac ctccaggcgg cgtcctcagc cccctcagct ctccgacgat 7441 gcgctgctac agggatatac gatatatata tatattatta cataccagac attcggttat 7501 aggttaccct gtatgcattt agttttagtt tctagttacg agagatctga gatttgcgag 7561 catttatgtg tgccttttaa cttgggttgt gtatttgtgt atttaaacta tttgaactat 7621 cttttaatcc ccttgcatct gtataatttt gatctaaaca gagatacaca acccagtgtg 7681 agaagcacat tagttttagc ctgtgtttcc cagcatgact ctgctcctat attttagtat 7741 ttatttttga gtgttcgagt gcgagtgcgg tgctgtctgc cacgcctcca aacaatggca 7801 tttatcggat tagggggggc gcgactgaaa tcgaatccga atcctgtgat aaaccgattc 7861 ttcgcgcctt cttaggtttt tcaaatgata tccaagtgtg ttcagcgcgc gtggcaggca 7921 gcttgaactt ttgagtgact gtgcgtgagt gagtgcgtga gtgatgtacg cgtttagtct 7981 ggcgcaatct cattatattt aaaaagaaaa aaccgacaaa aagttatgtt ttatgtttac 8041 catttttttt tgtgtgtgcg attaaagcta gaaaatccgg aagtttgaag gcaagaagac 8101 aaaacgccga tgcaatcggt ggtctgagca gaagaagaaa ccatgagaaa aagtttacga 8161 gaaacgcaaa tcataaggaa aaaaaatatg caaacgaaga aacacaaaat tctatcttat 8221 aagcaaagat aaatgtattt ttttttttgg acaggcataa agatgaaggc tatagctatg 8281 ggaatgagaa gaatatctgg agaagaaggc ttaggatacg tatattcatc agatatattg 8341 ataggccata ttaatgcaat ttctttacca cgtaagccca caaacgaaag caactgtaac 8401 acacaaagca aacaaacaaa cgagcaaaca tgcgagcaag cagacctgca atgaaaacac 8461 aaaaacaaac aaacgaagaa aagattcttt tcagcgcatg cgcagcagac ttagcactaa 8521 gtacgataag agtacgatct tgttagacct aagactcata tttttttttg ttagttgggg 8581 cccagtccct ccggggggac tacgccccgg tactctagct cgtaactctt cgattgttca 8641 acccccgacg cgcctaggtg taattgtact cgtaatcgta atcgtaattg taattgtatt 8701 tgaatgcagt ttatatatat ttatgactat atttatatat cgatgtatac atgtatatct 8761 aaaaacttaa acgactgatt atatattttc ccccgattag ttgtatactt aa