Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sidekick cell adhesion molecule


LOCUS       XM_070219317            8874 bp    mRNA    linear   INV 09-DEC-2024
            (sdk), transcript variant X2, mRNA.
ACCESSION   XM_070219317
VERSION     XM_070219317.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..8874
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..8874
                     /gene="sdk"
                     /note="sidekick cell adhesion molecule; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:108055805"
     CDS             416..7270
                     /gene="sdk"
                     /codon_start=1
                     /product="protein sidekick isoform X1"
                     /protein_id="XP_070075418.1"
                     /db_xref="GeneID:108055805"
                     /translation="MLKSAASSLRRRRPKTTATTAIEMPSLPQSASLLAALLVLCYCD
                     SCSFFCYADANPQPQQQNQNQLVQQQQLQAPRFTTHPSASGSIVSEGSTKILQCHALG
                     YPQPTYRWLKDGVPVGDFSSSQFYRFHSTRREDAGSYQCIARNDAGSIFSEKSDVVVA
                     YMGIFENTTEGRLTVISGHPAIFDMPAIESVPVPSVTWQSEDGPLSYDIKYAFTQANQ
                     LVILSADENDRKGYRAKATNTQLGKEESSPYVHLNVSGDPYIEVAPEIIVPPQDVKVK
                     MGTGVVELQCIANARPLHELETIWLKDGIAVETAGVRHTLSDPWNRTLALLQANSSHS
                     GEYTCQVRLRSGGYPAVSASAHLQILEPPVFFTPMRAETFGEFGGQVQLACDVVGEPT
                     PQVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTW
                     LRVKTKTAKIRVKRLAQPRILRVRASHAGLGSEKGSGSGSGSGSSGRRKEFRFASAPI
                     MELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGDLLISN
                     IRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSD
                     PSVPYNIDWYREGQSATPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNET
                     RAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELE
                     KFVGPVPDPLLNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSN
                     VVELPQEAPSGPPVGFVGSARSMSEIISQWQPPLEEHRNGQILGYILRYRLFGYNNVP
                     WSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPT
                     NVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWKDIERRMKTVPPS
                     LIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASIQVPVMTQDDVPDEITALHFD
                     DVSDRSVKVLWSPPRYSNGILTGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATT
                     HYWFEIFAWTRVGSGTPKTATIQSGVEPVLPHAPTSLALSNIEAFSVVLQFTPGFDGN
                     SSITKWKVEGQTARNMTWFTICEINDPDAETLTVTGLVPFTQYRMRLSASNVVGSSKP
                     SEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQVV
                     KAPGTVKYLPRSVVIEDHTANSHVLDGLEEWTLYEVKMNACNDVGCSKESETAVERTR
                     EAVPSYGPLDVQANATTSTTVVVQWGEVPPQHRNGQIDGYKVFYAATDREQKVLHKTI
                     PNNATFTTTLTELKKFVVYHVQVLAYTRLGNGALSTPPIRVQTFEDTPGVPSNVSFPD
                     VTLTMARIIWDVPMDPNGEILAYQVTYTLNGSAMLNYSREFPPSDRTFRATGLLPEKY
                     YSFSCTAQTRLGWGKIATALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDG
                     FAPLRYYTVEMRENEGRWQPLPERVDPLLSSYTALGLRPYMTYQFRIQATNDLGPSAF
                     SRESVVVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETGMWNGDAGTGGYRILYQQ
                     LSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYV
                     GEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGR
                     KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAP
                     LHLRFSDITMQSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQVKQKVSNTTLRV
                     QNLEEEVTYTFTVRAQTSVDYGPGVSENVTTGPQDGSPVAPRDLILTKTLSSVEMHWI
                     NGPSGRGPILGYLIEAKKREKGEPSFVYDSRWTKIEQTRKGMMQDFTVSYHILMPSTA
                     YTFRVIAYNRYGISFPVYSKDSILTPSKLHLEYGYLQHKPFYRQTWFMVSLAATSIVI
                     IVMVIAVLCVKSKSYKYKQEAQKTLEESMAMSIDERQELALELYRSRHGVGTGTLNSV
                     GTLRSGTLGTLGRKSTNRPPPGVHLGKSPPRPSPASVAYHSDEESLKCYDENPDDSSV
                     TEKPSEVSSSEASQHSESENESVRSDPHSFVNHYANVNDSLRQSWKKTKPVRNYSSYT
                     DSEPEGSAVMSLNGGQIIVNNMARSRAPLPGFSSFV"
     misc_feature    638..850
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    929..1177
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1205..1492
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1259..1273
                     /gene="sdk"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1304..1318
                     /gene="sdk"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1379..1393
                     /gene="sdk"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1421..1438
                     /gene="sdk"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1502..1777
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1556..1570
                     /gene="sdk"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1595..1609
                     /gene="sdk"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1670..1684
                     /gene="sdk"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1712..1729
                     /gene="sdk"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1751..1762
                     /gene="sdk"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1940..2197
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1985..1999
                     /gene="sdk"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2024..2038
                     /gene="sdk"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2096..2107
                     /gene="sdk"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2135..2152
                     /gene="sdk"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2174..2185
                     /gene="sdk"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2210..2482
                     /gene="sdk"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2258..2272
                     /gene="sdk"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2303..2317
                     /gene="sdk"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2378..2392
                     /gene="sdk"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2420..2437
                     /gene="sdk"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2459..2470
                     /gene="sdk"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2492..2815
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2492..2494,2735..2737,2780..2782)
                     /gene="sdk"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(2783..2788,2792..2797)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2840..3127
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(3092..3097,3101..3106)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    3149..3463
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    <3326..4579
                     /gene="sdk"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(3428..3433,3437..3442)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    4691..4969
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(4691..4693,4886..4888,4931..4933)
                     /gene="sdk"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(4934..4939,4943..4948)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    5024..>6295
                     /gene="sdk"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    5930..6208
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(5930..5932,6128..6130,6173..6175)
                     /gene="sdk"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(6176..6181,6182..6187)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    6227..6520
                     /gene="sdk"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(6227..6229,6452..6454,6497..6499)
                     /gene="sdk"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(6500..6505,6509..6514)
                     /gene="sdk"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     polyA_site      8874
                     /gene="sdk"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagcgcagtt tgttttgtgc gcgcgtggtg aacggttgtt tctcggctgc tcgtcgcgag
       61 attgcagttt cttcgatttg cgaattgcga ttgtgcgact tctggactgc cggactccga
      121 gttttagttg attgttgtga ttttgagcgt tctggacccg gacaaaacgt aattgttgtt
      181 acctttgacg ctctctgggg gcagagacaa gtactacaac aaaaagttat ccagaaagaa
      241 gaagaaaagc agtaagcgcg ccgtctcttt cccaccgatc gcgttttttc caaaaagatg
      301 tgagagatgc ataattaaaa ctagacctta gactaaaaag tagaaaagac gaaggaagac
      361 gaaggcggcc aaaaacattg aaggaaatcc aagaaatacc aaaagacaac aacaaatgct
      421 caaatccgcg gcgtcgtcgc tgcgtcgacg tcgtccaaaa acaacagcaa caacagccat
      481 tgagatgccg tcgctgccgc agtcggcgtc gctgcttgca gcgctgctcg tgctctgcta
      541 ctgcgacagc tgctcttttt tttgttacgc ggatgccaat ccacagccgc agcagcagaa
      601 ccagaatcag cttgtccagc agcagcagct gcaggcccca cgattcacca cgcatccatc
      661 ggcatcgggg tcgattgtca gcgagggcag caccaagata ctacagtgtc atgcgctggg
      721 atacccgcag cccacatatc gatggctgaa ggacggcgtc cccgtgggcg acttctcatc
      781 cagccagttc taccgattcc acagcactcg gcgcgaggat gcgggcagct atcagtgcat
      841 tgccaggaat gatgccggat ccatattcag cgagaagagc gacgttgtcg ttgcctacat
      901 gggcatcttt gagaacacca ccgagggtcg actgactgtg atcagtggtc atccggccat
      961 attcgatatg ccagccattg aatctgtgcc cgtgccatcg gttacgtggc aatcggagga
     1021 tggacccctg agctatgaca tcaagtacgc cttcacgcag gccaatcagt tggttatcct
     1081 gagtgcggat gagaacgatc gcaagggcta tcgggccaag gcgacaaata cccagttggg
     1141 caaggaggag agcagcccct atgtccatct aaatgtcagc ggagatccgt atatcgaggt
     1201 ggcacccgag atcatagtgc caccgcagga tgtcaaagtt aaaatgggaa ccggagtggt
     1261 ggaattgcag tgcattgcga atgcccgacc tctgcatgaa ttggaaacta tctggctgaa
     1321 agatggcatt gccgtggaaa cggccggcgt gaggcacact ctcagtgatc cctggaatcg
     1381 aactctggcc ctgctgcagg cgaatagctc gcattcgggc gaatatacct gccaggtgcg
     1441 attgcgcagt ggtggctatc cggccgtaag tgcttcggct catctgcaaa tcctcgaacc
     1501 gcctgtattc tttacaccca tgcgagcgga aacctttggc gaattcggtg gacaggtgca
     1561 gctagcctgc gatgtggttg gcgagccgac gccccaggtc aagtggttca ggaatgccga
     1621 atcggtggat gcacatatcg aaagcggaag atacacgttg aacacggata atacgctggt
     1681 aattaagaaa ctaatcctgg atgatgccgc catgtttcag tgtttggcca tcaacgaggc
     1741 gggcgagaat tcggcgagca cctggctgcg cgtgaaaaca aaaacggcca agatccgcgt
     1801 gaagcgtttg gcccagccgc gaatcctgag ggtaagagct tcgcatgctg gcttgggatc
     1861 ggaaaaggga tcgggatcgg gatcgggatc aggttcctcc ggtagacgca aggagtttcg
     1921 ctttgcatcg gctccgatta tggagttgcc gccccagaat gtcaccgctt tggatggcaa
     1981 ggacgcgact atttcctgcc gggccgtagg atcgcccaat ccgaatataa cctggatata
     2041 taacgagacc caactggtgg atatatccag ccgggtgcag atactcgaat cgggtgacct
     2101 gctcatctcg aacatccgat ccgtggacgc gggtctgtat atctgcgtgc gggccaacga
     2161 ggcgggcagc gtcaagggcg aggcctattt gagtgttttg gtgcggacac aaatcatcca
     2221 gccgccggtg gacacaacgg tgctacttgg cctgacggcc acgctgcagt gcaaggtgtc
     2281 cagtgatccc agtgtgccgt acaacatcga ctggtatcgc gagggtcagt cggcgacgcc
     2341 catcagtaat tcgcagcgca ttggcgtcca ggcggacggg cagctggaga tccaggcggt
     2401 gcgggccagc gacgtgggca gttatgcctg tgtggtcacc tcgcccgggg gaaatgagac
     2461 gcgggccgct cgcctcagcg tcatcgaact gccgttcccg ccgagcaatg tgaaggtgga
     2521 acgactgccg gagccgcaac agcgcagcat caacgtgtcc tggacaccgg gattcgatgg
     2581 caacagtcca atatccaaat ttattatcca gcgacgtgag gtctccgaat tggaaaaatt
     2641 cgtaggtcca gttccagacc ctctgctcaa ctggatcacc gaactgagca atgtctcggc
     2701 ggatcaacga tggatcctgc tcgagaacct caaggccgcc accgtctatc agtttagggt
     2761 tagtgccgta aatcgcgtgg gcgagggttc gccatcggaa cccagtaatg tggtcgaact
     2821 gccccaggaa gctccttccg gtccgccggt gggcttcgtt ggatccgctc gctccatgtc
     2881 ggagatcatc tcgcagtggc aaccgcctct ggaggagcat cgcaacggcc agatccttgg
     2941 ctacatactg cgctatcgcc tctttggcta caacaatgtg ccatggtcct atcagaatat
     3001 caccaacgaa gcacagcgca actttctcat ccaggagctg atcacatgga aggattacat
     3061 tgtacagatc gccgcctaca acaacatggg cgtgggcgtt tacaccgagg gttcgaagat
     3121 caagaccaag gagggagtac ccgaggcacc gccgacgaat gtgaaagtgg aggcgatcaa
     3181 ttcgacggcc gccagatgcc gatggacacc ccccaatccg cagcagataa atggcatcaa
     3241 tcagggctac aagattcagg catggcaaag acgattgatc gatggcgagt ggaaggatat
     3301 cgagagacgg atgaagacgg tgccgccgag tctcatcgat ccactggccg aacagacggc
     3361 cattcttggt ggcctggaga agttcaccga gtacaatatc agcgtgctgt gcttcacgga
     3421 tcccggcgat ggtgtggcca gtatccaagt gcccgtgatg acgcaggatg atgtgcccga
     3481 cgagatcacc gccttgcatt tcgatgatgt ctccgatcga tcggtgaagg ttctctggtc
     3541 accgccacgc tattcaaacg gcattttaac aggctacacg gttcgttacc aagtcaaaga
     3601 tcgtccggat accctgaaat catttaacct gactgctgat gataccgaat tgacggtgaa
     3661 tcagctgcag gccaccacac actattggtt cgagatcttt gcctggacgc gcgtgggcag
     3721 tggcactccg aaaacggcga ccattcaatc gggcgtggag ccagtccttc cccacgctcc
     3781 caccagcttg gccctgtcca atatcgaggc cttctccgtg gtgctgcaat ttacgccagg
     3841 tttcgatggg aactcgagca ttaccaagtg gaaggttgag ggtcagacgg caaggaatat
     3901 gacatggttc accatttgcg agatcaacga tcccgatgca gagactttga ctgtcacggg
     3961 tctagtgcca ttcacccaat atcgaatgag attgagtgcc agcaatgtgg tgggcagttc
     4021 gaaaccctcg gaggctacga aagatttcca gaccattcag gcgaggccca aacatccgcc
     4081 attcaatgtg acggtgaggg caatgagtgc ccagcagctg cgagttcgtt ggattccgct
     4141 gcaacagacc gagtggtatg gcaatcccag gggctataat atatcctaca agcaggtggt
     4201 caaggcaccc ggcaccgtaa aatatctacc acgttcggtg gtcatcgaag atcatacggc
     4261 caattcgcat gtgctcgacg gcctggagga gtggacgctg tacgaggtga agatgaatgc
     4321 ctgcaacgat gtgggctgct ccaaggagag cgagacggcg gtggagagga cccgggaagc
     4381 ggtgcccagc tatgggccac tggatgtcca ggcgaatgcc acgacatcga ccacagtggt
     4441 ggtgcaatgg ggcgaagtgc cgccgcagca caggaatggc cagatcgatg ggtacaaagt
     4501 tttctatgcg gcgacggatc gggagcaaaa ggtgctgcac aagacgatac cgaacaatgc
     4561 cacatttacc acaaccctga cggaattgaa gaagtttgtg gtctatcacg ttcaggtttt
     4621 ggcctacacg cgtttgggta atggtgcttt gagtactcca cccatcaggg ttcagacctt
     4681 tgaggatacc ccgggtgttc cgtcgaatgt tagctttccc gatgtcactt tgaccatggc
     4741 tcgcatcatc tgggatgtgc ccatggatcc gaatggcgag attctggcat atcaggtcac
     4801 ctacaccctg aatggcagtg ccatgttgaa ctacagtcgc gagtttccgc cctcggatcg
     4861 aacattccgg gccaccggtc tgctgcccga gaagtattac agttttagtt gcacggccca
     4921 gacgcgtttg ggttggggca agatagccac ggcactggtg tacaccacta ataataggga
     4981 gcgtccgcag gcgccgtcag tgccgcagat atcacgcagt cagattcagg cgcatcagat
     5041 caccttcagt tggacaccgg gaagggatgg cttcgcccca ctgcgttact acaccgtcga
     5101 gatgcgcgag aacgagggca ggtggcagcc gctgccggag cgagtggatc cgctgctgag
     5161 ttcgtacaca gcactcggat tgagacccta tatgacgtat cagtttcgca tacaggccac
     5221 caacgatctg ggaccctcgg cctttagtcg cgaaagtgtg gtggttagaa ctttgccagc
     5281 tgctccggcc gttggagtgg gaggtttaaa ggtggtgccc atcaccacga catcggtgcg
     5341 agtgcagtgg agtgctctgg agacgggaat gtggaatggt gatgcgggaa ccggtggcta
     5401 taggattctg tatcagcaac tctccgattt tcccaccgcc ctgcagtcga cacccaaaac
     5461 ggatgtgcac gggatcaatg agaatagtgt ggtgctatcg gatcttcagc aggatcgaaa
     5521 ctatgagatt gtggtgttgc cgtttaattc gcagggtcca ggacctgcca cgccccccgc
     5581 ggcggtgtat gtgggcgagg cggtgccgac gggcgaaccg cgagccgtgg acgcagctcc
     5641 catttccagc accgaagtgc gtctgctgtg gaagccaccg aagcagagca tgcagaatgg
     5701 cgatattctg ggctataaga tctactatct ggtcacctat tcaccgcagg cactggagcc
     5761 tgggcgcaag tgggaggagg aaatcgaggt ggtctcggcc acggccactt cgcacagtct
     5821 cgtctttctc gacaagttca ccgagtatcg catccaattg ctggccttta acccagcagg
     5881 agatggccca agatcagccc cgattactgt gaagacgctg ccaggagtgc cgagtgctcc
     5941 gcttcatctg cgcttctcgg acatcacgat gcagagcctg gaggtcacct gggatccacc
     6001 gaagttctta aacggcgaga ttttgggcta cctggtaacc tacgaaacca ccgaggagaa
     6061 tgagaaattt agcaagcagg tgaagcagaa ggtatccaat accacacttc gtgtgcagaa
     6121 tctggaggag gaggtaacct acacttttac ggtgcgggct caaacgtccg tggactacgg
     6181 accgggtgtg agtgagaatg tgacgacggg accccaagat ggatcccccg tggcgccacg
     6241 agatctcatc ttgaccaaga cgctgtccag cgtcgagatg cactggatca atgggccgtc
     6301 gggaagggga cccattttgg gttacctcat agaggccaag aagcgggaaa aaggagagcc
     6361 gtcatttgtt tacgattccc gctggacgaa aatcgagcag accaggaagg gcatgatgca
     6421 ggactttacg gtcagctatc acatcctgat gccctcgacg gcgtacacat tccgggtgat
     6481 tgcatacaat cgctatggca tttcgtttcc cgtttactcc aaggactcga tcctgacgcc
     6541 ctcgaaactg cacctggaat atggctatct gcagcacaag ccgttctatc ggcaaacctg
     6601 gtttatggtc tcactggcgg ccacctcgat tgtgatcata gtgatggtca ttgcggtgct
     6661 gtgtgtcaag agcaagagct acaaatataa gcaggaggcc cagaagacgc tggaggagtc
     6721 catggccatg tccattgacg agcgacagga gttggctttg gagttgtatc gctctcgtca
     6781 cggcgttgga accggcacac tgaacagcgt gggcactctg cgcagcggca ccttgggcac
     6841 tctgggcagg aagtccacca atcgaccgcc gccgggcgtc catctcggca agagtccgcc
     6901 acgcccctcg cccgcctccg tggcctacca cagcgacgag gagagcttga agtgctacga
     6961 cgagaatccg gacgacagca gtgtaaccga gaagccctcg gaggtgagca gttcggaggc
     7021 atcgcagcat tcggagagcg aaaacgagag cgtgcgcagt gatccgcatt cgtttgtgaa
     7081 tcactatgcc aacgtcaacg actcactgcg gcagtcgtgg aagaagacca aaccggtgcg
     7141 gaactactcc agctacaccg actcagagcc ggagggcagt gcagtgatga gcctcaatgg
     7201 tggccagatt atcgtcaata atatggccag atcgagggca ccactgcccg gcttctcgtc
     7261 gttcgtctga caatcaaccg agttctaaga tctaagcacc agtagcaacg gcaccgtcat
     7321 ccgcgagacc tttgtctaga cttgagggct tcaaaggagg aggaacaagg gatccggaga
     7381 aggaagacgg agctgggggc ttggctgggg gcgagtcggg acattggaga aggacaccac
     7441 acatatcaga ctggtccagg acctccaggc ggcgtcctca gccccctcag ctctccgacg
     7501 atgcgctgct acagggatat acgatatata tatatattat tacataccag acattcggtt
     7561 ataggttacc ctgtatgcat ttagttttag tttctagtta cgagagatct gagatttgcg
     7621 agcatttatg tgtgcctttt aacttgggtt gtgtatttgt gtatttaaac tatttgaact
     7681 atcttttaat ccccttgcat ctgtataatt ttgatctaaa cagagataca caacccagtg
     7741 tgagaagcac attagtttta gcctgtgttt cccagcatga ctctgctcct atattttagt
     7801 atttattttt gagtgttcga gtgcgagtgc ggtgctgtct gccacgcctc caaacaatgg
     7861 catttatcgg attagggggg gcgcgactga aatcgaatcc gaatcctgtg ataaaccgat
     7921 tcttcgcgcc ttcttaggtt tttcaaatga tatccaagtg tgttcagcgc gcgtggcagg
     7981 cagcttgaac ttttgagtga ctgtgcgtga gtgagtgcgt gagtgatgta cgcgtttagt
     8041 ctggcgcaat ctcattatat ttaaaaagaa aaaaccgaca aaaagttatg ttttatgttt
     8101 accatttttt tttgtgtgtg cgattaaagc tagaaaatcc ggaagtttga aggcaagaag
     8161 acaaaacgcc gatgcaatcg gtggtctgag cagaagaaga aaccatgaga aaaagtttac
     8221 gagaaacgca aatcataagg aaaaaaaata tgcaaacgaa gaaacacaaa attctatctt
     8281 ataagcaaag ataaatgtat tttttttttt ggacaggcat aaagatgaag gctatagcta
     8341 tgggaatgag aagaatatct ggagaagaag gcttaggata cgtatattca tcagatatat
     8401 tgataggcca tattaatgca atttctttac cacgtaagcc cacaaacgaa agcaactgta
     8461 acacacaaag caaacaaaca aacgagcaaa catgcgagca agcagacctg caatgaaaac
     8521 acaaaaacaa acaaacgaag aaaagattct tttcagcgca tgcgcagcag acttagcact
     8581 aagtacgata agagtacgat cttgttagac ctaagactca tatttttttt tgttagttgg
     8641 ggcccagtcc ctccgggggg actacgcccc ggtactctag ctcgtaactc ttcgattgtt
     8701 caacccccga cgcgcctagg tgtaattgta ctcgtaatcg taatcgtaat tgtaattgta
     8761 tttgaatgca gtttatatat atttatgact atatttatat atcgatgtat acatgtatat
     8821 ctaaaaactt aaacgactga ttatatattt tcccccgatt agttgtatac ttaa