Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Adenine nucleotide translocase 2


LOCUS       XM_070219287            1328 bp    mRNA    linear   INV 09-DEC-2024
            (Ant2), transcript variant X2, mRNA.
ACCESSION   XM_070219287
VERSION     XM_070219287.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1328
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1328
                     /gene="Ant2"
                     /note="Adenine nucleotide translocase 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 38 Proteins"
                     /db_xref="GeneID:108060871"
     CDS             145..1068
                     /gene="Ant2"
                     /codon_start=1
                     /product="ADP,ATP carrier protein"
                     /protein_id="XP_070075388.1"
                     /db_xref="GeneID:108060871"
                     /translation="MGDEGGGGGHGKGDLKSFLMDFMMGGVSAAVAKTAVAPIERVKL
                     LLQVQEVSKQISADQRYKGIVDCFVRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFK
                     DVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGQGGN
                     REFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTP
                     FYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGI
                     GAFFKGALSNIIRGTGGALVLAIYDEMKKYF"
     misc_feature    187..1059
                     /gene="Ant2"
                     /note="ADP/ATP transporter on adenylate translocase;
                     Provisional; Region: PTZ00169"
                     /db_xref="CDD:240302"
     polyA_site      1328
                     /gene="Ant2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcaccccaag cgccaccaaa cgtcccacca cttcacgaat ttcattcgcc aagtgagcac
       61 gcggcttcgt ctggttctgc aaaagaagtt tttattctgt gacttttgtg agaagttatc
      121 aactgaagca accagtaatc caacatgggc gatgaaggcg gtggcggcgg acatggcaag
      181 ggcgacctca agtccttcct catggacttc atgatgggcg gcgtttcggc ggcggtggcc
      241 aagacggcgg tggcgcccat cgagcgggtg aagctgctcc tgcaggtcca ggaggtgtcc
      301 aagcagatct ccgcggacca gcgctacaag ggcatcgtcg actgtttcgt gcgcattccc
      361 aaggagcagg gattctcgtc cttctggcgc ggcaacttgg ccaacgtgat ccgttacttt
      421 cccacgcagg ccctcaactt tgccttcaag gatgtgtaca aatcggtctt cctcggcggc
      481 gttgacaagc acaagcagtt ctggcgccac tttgcaggaa acttggcctc tggcggcgca
      541 gcaggcgcca catccttgtg cttcgtctat cccctggact ttgcccgaac ccgcttggcc
      601 gccgacgtgg gccagggcgg caatcgggag ttcaacggcc tgatcgactg cctgatgaag
      661 gtgataaaga gcgatggccc cattggcctg taccgcggct tcattgtgtc ggtgcagggc
      721 atcgtcatct accgtgcggc ctacttcggc ttctacgaca cctgccgcga cttcctgccg
      781 aatccaaaga gcacgccctt ctacgtcagc tgggcgatcg cccaggtggt caccaccgtg
      841 gccggcatcg cttcctatcc cttcgacacg gtgcgccgtc gcatgatgat gcagtcgggc
      901 ctgaagaagt ccgagatggt ctacaagaac acggcccact gctggctggt gattgccaag
      961 caggagggca tcggcgcctt cttcaagggc gccctctcga acatcatccg cggcacgggc
     1021 ggcgccctgg ttctcgccat ttacgacgag atgaagaagt acttttagcc ccgatgtcgg
     1081 gccgtttgtg gtgagtccat tcggccgcca tctagcaacc cagccgcacc aaatagcaca
     1141 ccacgagggc gccgcacctg cagatcccca gcccaccgtt tcatcgcttc gtaaaggaag
     1201 actgggacca gtccatcggc caggaggccc ataaattagt gatttaatcg ggatgctggc
     1261 tgcccctcat ctcaagatgt gttcttcgcc agtggttgag aaaatacaaa taatttattg
     1321 aacttaaa