Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219281 1150 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070219281 VERSION XM_070219281.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1150 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1150 /gene="LOC108060995" /note="frequenin-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins" /db_xref="GeneID:108060995" CDS 453..1016 /gene="LOC108060995" /codon_start=1 /product="frequenin-1" /protein_id="XP_070075382.1" /db_xref="GeneID:108060995" /translation="MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLT EQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQ WAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDENTPQKRVDKIFDQMDKNHD GKLTLEEFREGSKADPRIVQALSLGGG" misc_feature 567..719 /gene="LOC108060995" /note="EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to...; Region: EFh; cl08302" /db_xref="CDD:415501" misc_feature <657..971 /gene="LOC108060995" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 1150 /gene="LOC108060995" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgcagagcgc tttcagtcgc tgatttgacc gccaaacaaa cgcaacgcag ctcggctggt 61 tttcaaaaaa ataacaaaaa aaacaaaaaa cgcctcgaca acaaaaaaaa aggccaaaac 121 gcgctctccg gtccacagaa aaacaacaat aacaaccaac agcaacaata acaaaataaa 181 gcaatttcat gtagttggtt tgttaacctt attgtttttt ttccaagttc aatccaccaa 241 aaatagttga catttttttt cggttttcca aaaaaaatat acaaaaataa taaacaaaaa 301 attaaacaaa aacaacagca aacaaaaaaa ttgcaaagta aaacgaactt gcgcaacaaa 361 aaagtttcgc cactaaagag caatagcagt caagtgcaac aacaacaaca gcaacagaaa 421 caacaacagc aactagccgc aacaagaaca acatgggaaa aaagagctcc aagttgaaac 481 aggataccat tgatcgctta acaacggaca catacttcac agagaaagaa atacgtcaat 541 ggcacaaagg attcctgaaa gactgtccca acggcctgct cacagagcaa ggcttcatca 601 aaatctacaa acaattcttt ccacaaggcg atcccagtaa attcgcatcg ctcgtctttc 661 gtgtcttcga tgagaacaat gatggctcca tcgagtttga ggagttcata cgcgccttat 721 ccgtcacatc gaagggcaac ctggacgaaa aactgcagtg ggccttccgt ctatacgatg 781 tggacaacga tggctacata acgcgggagg agatgtacaa catagtggat gcgatctatc 841 agatggtggg ccagcagccg caatcggagg acgagaatac gccgcagaag cgagtggaca 901 agatcttcga tcaaatggat aaaaaccacg acggcaaatt aacattagaa gaatttcgtg 961 agggtagtaa agctgatcca cgtatagttc aggcgttaag tttaggtggt ggttaaaccg 1021 attaacaatg gccgtttacc gatataacca acagacccaa ttccaattcc acaaaaatca 1081 agcgcgcaat aaaccaaaaa aaaaatccct cgatactgac actgaaattt gatctaaaaa 1141 aaaaccgaaa