Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii frequenin-1 (LOC108060995),


LOCUS       XM_070219281            1150 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_070219281
VERSION     XM_070219281.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1150
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1150
                     /gene="LOC108060995"
                     /note="frequenin-1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 20 Proteins"
                     /db_xref="GeneID:108060995"
     CDS             453..1016
                     /gene="LOC108060995"
                     /codon_start=1
                     /product="frequenin-1"
                     /protein_id="XP_070075382.1"
                     /db_xref="GeneID:108060995"
                     /translation="MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLT
                     EQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQ
                     WAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDENTPQKRVDKIFDQMDKNHD
                     GKLTLEEFREGSKADPRIVQALSLGGG"
     misc_feature    567..719
                     /gene="LOC108060995"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cl08302"
                     /db_xref="CDD:415501"
     misc_feature    <657..971
                     /gene="LOC108060995"
                     /note="Ca2+-binding protein, EF-hand superfamily [Signal
                     transduction mechanisms]; Region: FRQ1; COG5126"
                     /db_xref="CDD:444056"
     polyA_site      1150
                     /gene="LOC108060995"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgcagagcgc tttcagtcgc tgatttgacc gccaaacaaa cgcaacgcag ctcggctggt
       61 tttcaaaaaa ataacaaaaa aaacaaaaaa cgcctcgaca acaaaaaaaa aggccaaaac
      121 gcgctctccg gtccacagaa aaacaacaat aacaaccaac agcaacaata acaaaataaa
      181 gcaatttcat gtagttggtt tgttaacctt attgtttttt ttccaagttc aatccaccaa
      241 aaatagttga catttttttt cggttttcca aaaaaaatat acaaaaataa taaacaaaaa
      301 attaaacaaa aacaacagca aacaaaaaaa ttgcaaagta aaacgaactt gcgcaacaaa
      361 aaagtttcgc cactaaagag caatagcagt caagtgcaac aacaacaaca gcaacagaaa
      421 caacaacagc aactagccgc aacaagaaca acatgggaaa aaagagctcc aagttgaaac
      481 aggataccat tgatcgctta acaacggaca catacttcac agagaaagaa atacgtcaat
      541 ggcacaaagg attcctgaaa gactgtccca acggcctgct cacagagcaa ggcttcatca
      601 aaatctacaa acaattcttt ccacaaggcg atcccagtaa attcgcatcg ctcgtctttc
      661 gtgtcttcga tgagaacaat gatggctcca tcgagtttga ggagttcata cgcgccttat
      721 ccgtcacatc gaagggcaac ctggacgaaa aactgcagtg ggccttccgt ctatacgatg
      781 tggacaacga tggctacata acgcgggagg agatgtacaa catagtggat gcgatctatc
      841 agatggtggg ccagcagccg caatcggagg acgagaatac gccgcagaag cgagtggaca
      901 agatcttcga tcaaatggat aaaaaccacg acggcaaatt aacattagaa gaatttcgtg
      961 agggtagtaa agctgatcca cgtatagttc aggcgttaag tttaggtggt ggttaaaccg
     1021 attaacaatg gccgtttacc gatataacca acagacccaa ttccaattcc acaaaaatca
     1081 agcgcgcaat aaaccaaaaa aaaaatccct cgatactgac actgaaattt gatctaaaaa
     1141 aaaaccgaaa