PREDICTED: Drosophila takahashii protein snakeskin-like

LOCUS       XM_070219278             433 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913950), mRNA.
ACCESSION   XM_070219278
VERSION     XM_070219278.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 33% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..433
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..433
                     /gene="LOC138913950"
                     /note="protein snakeskin-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913950"
     CDS             104..433
                     /gene="LOC138913950"
                     /codon_start=1
                     /product="protein snakeskin-like"
                     /protein_id="XP_070075379.1"
                     /db_xref="GeneID:138913950"
                     /translation="MSIVLIESISDLTFIRQAMVVYGTLIGYLITCFILATGHVGGTG
                     VDKRLEILFSIGGFVLFVATGVIILDQWLGYCKSQEDREVLLVSGILSLATGAIFVGD
                     IFVILGS"
ORIGIN      
        1 cttgtccgtt tgtccgtatc tgtctctgag tttgtccgtc tatgaatttt tgtccgtcac
       61 atttgctgag caccgagttc ttaactccca ggtctttatc gtcatgagca ttgtgctgat
      121 cgagagcatt tcggatctga cctttatcag gcaagcgatg gtggtctatg gcactctaat
      181 cggctacctt atcacctgct ttattctggc cacaggacat gtgggcggca ctggtgtgga
      241 caagcgcctc gaaatcctct tctcgatcgg cggctttgtc ctgttcgtgg ccacgggtgt
      301 tattatcctg gaccagtggc tgggatactg caagtcgcag gaggacaggg aagtgctgct
      361 ggtctccggc atcctgagtc tcgccactgg agctatcttc gtaggcgata ttttcgttat
      421 attgggctct tga