Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Adenosine deaminase acting on RNA


LOCUS       XM_070219265            1151 bp    mRNA    linear   INV 09-DEC-2024
            (Adar), transcript variant X12, mRNA.
ACCESSION   XM_070219265
VERSION     XM_070219265.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1151
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1151
                     /gene="Adar"
                     /note="Adenosine deaminase acting on RNA; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063839"
     CDS             549..1151
                     /gene="Adar"
                     /codon_start=1
                     /product="double-stranded RNA-specific editase Adar
                     isoform X5"
                     /protein_id="XP_070075366.1"
                     /db_xref="GeneID:108063839"
                     /translation="MCSRVGVMLNSANNNSPQHPVSAPSDINMNGYNRKSPQKRRYEM
                     PKYAVSPKKKTCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQ
                     KYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPSGNLDFTSDEHLENGIENLS
                     NKQLVEIIEPLMLTEKKSNLTSLEQPTLRLQMFCMSQSKY"
     misc_feature    738..926
                     /gene="Adar"
                     /note="first double-stranded RNA binding motif of STRBP,
                     ILF3, RED1, RED2 and similar proteins; Region:
                     DSRM_STRBP_RED-like_rpt1; cd19865"
                     /db_xref="CDD:380694"
     misc_feature    order(738..740,747..752,759..764,768..770,810..815,
                     819..821,825..827,876..884,891..893)
                     /gene="Adar"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:380694"
ORIGIN      
        1 tgatcggcgc ttccccacct ctacagaact ctaaccgacg aagtgtcatt gttttttttt
       61 ctaatgtaat ggacttaaat ctttgcattc gaatcgagtg aatccgggac tgcagtctcc
      121 cccccgaaca ccaaacaccc aatcgaattc gcggccagag gagcggatag agagcaccga
      181 ggatagagga aacgcttaaa attgatttgt ttgtccggcc atgtcagtgt gtgtgtgaca
      241 agggctcgtc cgtgtgcgtg cgcctgtcgc tgtgtgtgtg tgctctcttt tttttcttcc
      301 tatcgagtgc cgctaaattg aataattgca gtaagagcca ccaatataaa tatatgtata
      361 tcctaccccc ctctcctaca aaggaacagt aaaaataaga gcaagaggaa gaacactaac
      421 tagcgttaaa caaatgaaac tctgccgata cagcgaagta aaaatcaata attagagctc
      481 gttcgcaagc gaaaaaggta tgcagtagag ccaaaaaaac acagaacgca acatacatac
      541 atctgtacat gtgcagccgt gtaggagtca tgttaaacag cgcaaataac aattctcccc
      601 agcacccggt gagtgcacca tctgatatca acatgaacgg atataaccgg aagtcgcctc
      661 aaaaacggcg ctatgagatg ccaaaatatg ctgtatcacc aaaaaagaaa acctgcaagg
      721 agcgcattcc gcagccaaag aatacggtgg caatgctgaa tgagttaaga catggactga
      781 tttacaaatt ggagtcacag actggtccgg tgcacgcacc tttatttacg atatccgttg
      841 aggtcgatgg acagaaatac ttgggccagg gtcgcagtaa aaaagttgca cgcatcgagg
      901 cagctgccac agcactgcga agctttatac aattcaagga cggagccgtc ttgtcgccat
      961 tgaagccatc gggcaacttg gactttacca gcgatgaaca tctagaaaat ggtattgaaa
     1021 atttgtccaa caaacaattg gtcgagatca ttgagccgtt gatgttgact gaaaagaaat
     1081 ccaaccttac ctcgcttgaa caacccacgt tgcgtcttca aatgttttgc atgagtcaga
     1141 gcaagtatta g