Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219265 1151 bp mRNA linear INV 09-DEC-2024 (Adar), transcript variant X12, mRNA. ACCESSION XM_070219265 VERSION XM_070219265.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1151 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1151 /gene="Adar" /note="Adenosine deaminase acting on RNA; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063839" CDS 549..1151 /gene="Adar" /codon_start=1 /product="double-stranded RNA-specific editase Adar isoform X5" /protein_id="XP_070075366.1" /db_xref="GeneID:108063839" /translation="MCSRVGVMLNSANNNSPQHPVSAPSDINMNGYNRKSPQKRRYEM PKYAVSPKKKTCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQ KYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPSGNLDFTSDEHLENGIENLS NKQLVEIIEPLMLTEKKSNLTSLEQPTLRLQMFCMSQSKY" misc_feature 738..926 /gene="Adar" /note="first double-stranded RNA binding motif of STRBP, ILF3, RED1, RED2 and similar proteins; Region: DSRM_STRBP_RED-like_rpt1; cd19865" /db_xref="CDD:380694" misc_feature order(738..740,747..752,759..764,768..770,810..815, 819..821,825..827,876..884,891..893) /gene="Adar" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:380694" ORIGIN 1 tgatcggcgc ttccccacct ctacagaact ctaaccgacg aagtgtcatt gttttttttt 61 ctaatgtaat ggacttaaat ctttgcattc gaatcgagtg aatccgggac tgcagtctcc 121 cccccgaaca ccaaacaccc aatcgaattc gcggccagag gagcggatag agagcaccga 181 ggatagagga aacgcttaaa attgatttgt ttgtccggcc atgtcagtgt gtgtgtgaca 241 agggctcgtc cgtgtgcgtg cgcctgtcgc tgtgtgtgtg tgctctcttt tttttcttcc 301 tatcgagtgc cgctaaattg aataattgca gtaagagcca ccaatataaa tatatgtata 361 tcctaccccc ctctcctaca aaggaacagt aaaaataaga gcaagaggaa gaacactaac 421 tagcgttaaa caaatgaaac tctgccgata cagcgaagta aaaatcaata attagagctc 481 gttcgcaagc gaaaaaggta tgcagtagag ccaaaaaaac acagaacgca acatacatac 541 atctgtacat gtgcagccgt gtaggagtca tgttaaacag cgcaaataac aattctcccc 601 agcacccggt gagtgcacca tctgatatca acatgaacgg atataaccgg aagtcgcctc 661 aaaaacggcg ctatgagatg ccaaaatatg ctgtatcacc aaaaaagaaa acctgcaagg 721 agcgcattcc gcagccaaag aatacggtgg caatgctgaa tgagttaaga catggactga 781 tttacaaatt ggagtcacag actggtccgg tgcacgcacc tttatttacg atatccgttg 841 aggtcgatgg acagaaatac ttgggccagg gtcgcagtaa aaaagttgca cgcatcgagg 901 cagctgccac agcactgcga agctttatac aattcaagga cggagccgtc ttgtcgccat 961 tgaagccatc gggcaacttg gactttacca gcgatgaaca tctagaaaat ggtattgaaa 1021 atttgtccaa caaacaattg gtcgagatca ttgagccgtt gatgttgact gaaaagaaat 1081 ccaaccttac ctcgcttgaa caacccacgt tgcgtcttca aatgttttgc atgagtcaga 1141 gcaagtatta g