Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Neuroglian (Nrg), transcript


LOCUS       XM_070219261            5191 bp    mRNA    linear   INV 09-DEC-2024
            variant X3, mRNA.
ACCESSION   XM_070219261
VERSION     XM_070219261.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5191
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..5191
                     /gene="Nrg"
                     /note="Neuroglian; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 11 Proteins"
                     /db_xref="GeneID:108055215"
     CDS             361..4077
                     /gene="Nrg"
                     /codon_start=1
                     /product="neuroglian isoform X2"
                     /protein_id="XP_070075362.1"
                     /db_xref="GeneID:108055215"
                     /translation="MWRQSTILAALLVALITGCAAVKSNSPPRITKQPAPGELLFKVA
                     QQNKESDNPFIIECEADAQPEPEYSWVKNGKKFDWQAYDNRMLRQPGRGTLVITIPKD
                     EDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEMPKTLEAVEGEPFMLKCAAPDGF
                     PSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFR
                     SEYKIGNKVLLDVKQMGVSASQNKHQPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQ
                     TVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNV
                     NSVPYFTKEPDFQTAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQTPPNPRRTVTDN
                     TIRIVNLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTIEVPPSDVSSVDGRNITI
                     KCRVKGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEI
                     QADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEA
                     QPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITC
                     QADKAEIQWEPQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWAN
                     YTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIE
                     HNAPNFHYYVSWKRDIPAASWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDKGES
                     NVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTW
                     TENEGEEGLREIHVKGDTHNALVTQFKPDSKNFARILAYNGRFNGPPSAVIDFDTPEG
                     VPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHIT
                     DPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAINVAPATPSFSWEQ
                     LPSDNGLAKFRINWQPSQEGHPGTHFFTMYRIKGETQWLRKDEEKNSDYQEVSGLDPD
                     TAYEFRVVSVDGHFNTESATQEIDTNTVEGPIIQPNETVANAGWFIGMMLALAFIIIL
                     FIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANKP
                     GVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL"
     misc_feature    442..741
                     /gene="Nrg"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    520..534
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    559..573
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    637..651
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    679..696
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    721..732
                     /gene="Nrg"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    793..1005
                     /gene="Nrg"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    808..822
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    850..864
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    931..945
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    982..999
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1108..1353
                     /gene="Nrg"
                     /note="Immunoglobulin domain; Region: ig; pfam00047"
                     /db_xref="CDD:395002"
     misc_feature    1150..1161
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1186..1200
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1255..1269
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1297..1314
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1339..1350
                     /gene="Nrg"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1372..1638
                     /gene="Nrg"
                     /note="Fourth immunoglobulin (Ig)-like domain of hemolin,
                     and similar domains; a member of the I-set of IgSF
                     domains; Region: IgI_4_hemolin-like; cd20978"
                     /db_xref="CDD:409570"
     misc_feature    1372..1383
                     /gene="Nrg"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409570"
     misc_feature    1399..1410
                     /gene="Nrg"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409570"
     misc_feature    1423..1446
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    1462..1479
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1486..1494
                     /gene="Nrg"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409570"
     misc_feature    1516..1530
                     /gene="Nrg"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409570"
     misc_feature    1534..1548
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1573..1599
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1606..1638
                     /gene="Nrg"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    1651..1908
                     /gene="Nrg"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    1702..1716
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1741..1755
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1804..1818
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1846..1863
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1885..1896
                     /gene="Nrg"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1918..2202
                     /gene="Nrg"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1969..1983
                     /gene="Nrg"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2014..2028
                     /gene="Nrg"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2086..2100
                     /gene="Nrg"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2128..2145
                     /gene="Nrg"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2167..2178
                     /gene="Nrg"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2194..2478
                     /gene="Nrg"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    2404..3759
                     /gene="Nrg"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2443..2448,2452..2457)
                     /gene="Nrg"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2806..3072
                     /gene="Nrg"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(3058..3063,3067..3072)
                     /gene="Nrg"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3106..3108,3316..3318,3361..3363)
                     /gene="Nrg"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3109..3378
                     /gene="Nrg"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3820..4068
                     /gene="Nrg"
                     /note="Bravo-like intracellular region; Region:
                     Bravo_FIGEY; pfam13882"
                     /db_xref="CDD:464016"
     polyA_site      5191
                     /gene="Nrg"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgatgttttt gaaagtatcg cgcaaagtat cgcccaaatg tacaccccag gccaaattcc
       61 catccgttct cattcaattt tttaatttcg actcgcgctg ctgtgctccg ttgttgcaac
      121 agaacagcag aaagtaataa aagctcggct cgcatgcaat tttcattagt gggaaaattg
      181 cttgatattt aagaggcaac cgaggaacaa accgaatcaa cagcagcagc agcaggcaga
      241 cagacacaca cattccaaac taaattaata ataggaaaaa aataaaagtt aaagccaaaa
      301 caaaccaaaa ccaaacgaaa cacaatcgag ggcgcgagcg gagtgccaga aacgacgaaa
      361 atgtggcggc agtcaacgat actggccgcg ttattagtgg ctcttataac gggctgtgca
      421 gcagtcaaaa gcaactcccc accaagaatc accaaacaac cggcacccgg agaactgctc
      481 ttcaaagtag cgcaacagaa taaggaaagt gacaatccat ttattatcga atgcgaagcc
      541 gatgcacaac ccgaaccaga atatagttgg gtgaagaatg gcaagaagtt cgactggcag
      601 gcgtacgaca accggatgct gcgacagcct ggccgcggca ccctggtgat caccataccc
      661 aaggacgagg atcgcggcca ctaccagtgc tttgcgtcca acgaattcgg aacggcgacc
      721 tcgaactcgg tgtatgtgcg caaggcggag ctgaatgcct tcaaggacga gatgcccaag
      781 actttggagg cggtggaggg cgagcccttc atgctcaagt gtgccgcccc cgatggcttt
      841 cccagtccga ccgtcaactg gatgatccag gagtccatcg acggcagcat caagtcgatc
      901 aacaactcgc gcatgaccct cgatcccgag ggcaatctct ggttctcgaa cgtgacccgc
      961 gaggatgcca gctcggactt ctactacgcc tgctcggcca cctccgtttt ccgcagcgag
     1021 tacaagatcg gcaacaaggt gctgctcgac gtcaagcaga tgggcgtgag tgcctcgcag
     1081 aacaaacacc agcccgtccg ccagtatgtt tcgcgtcgcc agtcgctggc gctgcgcggc
     1141 aagcgcatgg aactcttctg catctacggc ggcactccgc tgccgcagac cgtctggagc
     1201 aaggatggcc agcggataca gtggagcgac aggatcaccc agggacacta cggcaagtcg
     1261 ctggtcatca ggcagacgaa cttcgacgat gccggcacct acacctgcga cgtctcgaac
     1321 ggcgtcggca atgcccagtc cttctcgatc atcctcaatg tcaactcggt gccgtatttc
     1381 accaaggaac ccgacttcca gaccgccgcc gaggacgagg aggtggtctt cgagtgccgc
     1441 gccgccggtg tgcccgagcc gaagatcagt tggattcaca atggcaagcc catcgagcag
     1501 acgccaccga atccccggcg aaccgtcacg gacaacacga tccggatcgt taatctggtc
     1561 aagggcgata cgggtaacta cggctgcaac gccaccaact cgctgggcta cgtctacaag
     1621 gatgtctatc tgaatgtcca ggccgagccg ccaaccattg aagttccccc ctcggacgtc
     1681 tccagtgtgg atgggcgaaa catcacgatc aagtgccgcg tgaagggatc ccccaagccg
     1741 ctggtcaagt ggctgagggc cagcaactgg ctgaccggcg gtcgctacaa tgttcaggct
     1801 aacggcgatc tggagatcca ggacgtgacc ttctcggatg ccggcaagta cacgtgctat
     1861 gcgcagaaca agttcggtga gatccaggcg gacgggtcgc tggtggtcaa ggagcacacg
     1921 cgcatcaccc aggagccgca gaactacgag gtggccgccg gacagtcggc cacattccgc
     1981 tgcaacgagg cgcacgacga tacgctggag atcgagatcg attggtggaa ggacgggcag
     2041 tcgattgact ttgaggcgca gccgcgtttc gtgaagacca acgacaattc gctgaccatt
     2101 gccaagacca tggagctgga ttcgggcgag tatacgtgtg tggcgaggac gcgactggat
     2161 gaggcaacgg ccagggccaa tttgattgtc caggatgtgc cgaatgcccc aaaactaacg
     2221 ggcatcacct gccaggcgga caaggcggag attcagtggg agccgcaggg cgacaaccgc
     2281 tcgcccattc tgcactacac cattcagttt aatacgagct tcacgcccgc ctcgtgggat
     2341 gccgcgtacg agaaggtgcc caatacggac tcctccttcg ttgtccaaat gtcgccgtgg
     2401 gccaactaca cgttccgtgt gatcgccttc aacaagatcg gtgcctcgcc gccgtcggcg
     2461 cacagcgaca gctgcaccac ccagccggat gtgcccttca agaatcccga caatgtcgtc
     2521 ggccagggca ccgagccgaa taatctggtc atctcgtgga ctcccatgcc cgagatcgag
     2581 cacaatgcgc ccaatttcca ttactacgtg agctggaaac gcgacattcc ggcggcgtcg
     2641 tgggagaata acaacatctt tgactggcga cagaacaaca ttgtgatcgc cgatcagccg
     2701 acgttcgtca agtatctgat caaggtggtg gccatcaacg acaagggcga atcgaatgtg
     2761 gccgccgagg aggtggtcgg ctattccggc gaggatcgtc ccctggacgc gcccaccaac
     2821 tttacgatgc gacagatcac ctcgtcgacc agcggctata tggcctggac accggtgagc
     2881 gaggagtcgg tgaggggtca cttcaagggc tacaagatcc agacgtggac ggagaacgag
     2941 ggcgaggagg gtctgcggga gatccatgtg aagggcgata cgcacaacgc cctggtcacc
     3001 cagtttaagc ccgactcgaa gaactttgcc cgcatcctgg cctacaacgg tcgcttcaat
     3061 gggccgccca gtgcggtcat cgatttcgat acacccgagg gtgtgccgtc gccggtccag
     3121 ggattggatg cctatccact gggctcctcg gccttcatgc tgcactggaa gaagccgctg
     3181 tatcccaatg gcaagctcac cggctacaag atctactacg aggaggtcaa ggagagctat
     3241 gtgggcgagc ggcgggagta cgatccccat atcaccgatc ccagggtcac gcgcatgaag
     3301 atggccggtc tgaagcccaa ctccaagtat cgcatctcca tcacggccac cacgaaaatg
     3361 ggcgagggat ctgagcacta catcgagaag acgacgctga aggacgccat caatgtggcc
     3421 ccggccacgc cctcattctc ctgggagcaa ctgccctccg acaatggact ggccaagttc
     3481 cgcatcaact ggcagccaag tcaggaaggt cacccgggca ctcacttctt caccatgtac
     3541 aggatcaagg gcgaaaccca gtggctgcgc aaggacgagg agaagaactc cgactaccag
     3601 gaggttagcg gcctggatcc agacaccgcc tacgagttcc gcgtggtctc cgtcgatggg
     3661 cacttcaata cggagagtgc cacgcaggag atcgacacga acaccgtcga gggaccgatc
     3721 atacagccca acgagacggt ggcgaatgca ggttggttca tcggcatgat gctggccctg
     3781 gccttcatca ttatcctgtt catcatcatc tgcattatcc ggcgcaatcg gggcggcaag
     3841 tacgacgttc acgatcggga gctggccaac ggccggcggg attatcccga agagggcggc
     3901 ttccacgagt actcgcaacc gttggataac aagagcgctg gtcgccaatc cgtgagttca
     3961 gcgaacaaac ccggcgtgga aagcgacacc gattcgatgg ccgaatacgg tgatggcgac
     4021 acaggcatga acgaagatgg atcctttatt ggccaatatg gacgcaaagg actttgattt
     4081 aattagtaag cagcgcgccg caacagcaac tcaaaaaata tcgaaaccga gccctttacc
     4141 ccaaaaatca acaagaccaa acaccatcac agcagagaaa gaaaaacacg aatggaacca
     4201 ttcaagaaat actacccagc catgaaatgg gtatcaacta atttttattc gattaagtgc
     4261 aaagaaccac gattatttta aagtatatat aaaattagac gttttatata tagctattaa
     4321 aattaaaaaa ttaaaaatat gtaaaaaaca aacgcaaatc aatactgcca aacaacatga
     4381 acaacacaac agcaacaaca acaacaacaa cgaggatgca gcaaaaaggc tattaacaca
     4441 ataaaagtct tcatcggaag aagtagtaat cgaaaaagaa aatgcatgcg aatcaatgat
     4501 aaaggagaac catatatttt tccggaaata atcgggcagc agctgcgtgt aatttttttt
     4561 gttaagaaat ttaagaaact atgaggaaaa tgaagctcgc ttttaaaatc tctatattgc
     4621 gcacacgtct acctgtccca ctctgtcccc cggcactctg tatatctctg tcccgctctc
     4681 tcccctcttc tacttgtaat gcatatatat ttataaatat aaagcgtaaa taagttataa
     4741 tttaataatt tttttataaa aacaacactc gaatgtaaaa tctccgtttt agattggccg
     4801 taaatcgtaa atcgaaatga aaccccttta gcttacatgt ttactacttt atttaagcct
     4861 attgtgtgta ttttgttttt atttctttat tttatttttt tagttcgtgt aatgactttg
     4921 aattttttgc tttaattttg gacagtgaaa cagcgtttta aaatgtatac accacagatg
     4981 tatgtacaag tttccctgtt tgttttcctt gtttgtaccg ggaacagcga caaaacgaag
     5041 tctatttttt cagtgtattt aatattaaag aatgaatgaa gagaacatca tgattatgaa
     5101 aatataattt tttttacata tgttgatgta ctttcgcata ttaaattaga aagaaaatca
     5161 aatgaaataa agaaaaccga ataataaaca a