Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219211 1182 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070219211 VERSION XM_070219211.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1182 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1182 /gene="ccb" /note="central complex broad; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108055895" CDS 132..980 /gene="ccb" /codon_start=1 /product="uncharacterized protein ccb" /protein_id="XP_070075312.1" /db_xref="GeneID:108055895" /translation="MSIPENPEMNIEGEATLRAQRYTWDEFCGVVGGFAVPRFVWQLI LCRDLRLSGLWLFLGLVVIDFLTSHSLPQLLGMAGLMLLVHLLIYSAIRPYVRFLPYE ELLDCRINVSKSLDLGVRVVGQVANCINRSVATAQFLLLGTDLQASLLLLFVLMEVRA ILCWINLSTLIKIAYCLAIVVPKLWEAFLLWMDSRGLNNPYLIALLKEVFSREFIFEC LEQLAMEVQLYSAKYFELEAEKTEPEGANSGEIQVADVDTTGDEMSMESGEEIQVAVV DRTGQD" misc_feature <486..689 /gene="ccb" /note="Region: Reticulon; pfam02453" /db_xref="CDD:460562" ORIGIN 1 cccacattca gcagtcagtt gacaattccc ttcagttata accagaactc cgtcgactca 61 acaacgaaat cgaaaaatta tttattttcc tagtgcattt ttacttcaag aacttcattg 121 gttgaacaat catgagtatt cccgagaatc cagagatgaa tatagagggg gaggcaactt 181 tgcgagcaca gagatataca tgggatgagt tttgcggggt ggtgggcggc tttgccgtgc 241 cccgcttcgt gtggcaattg atcctgtgcc gcgatctcag actcagtggc ctctggttgt 301 tcctcggact cgtggtcatc gacttcctga ccagtcactc gctgccccag ctgctgggca 361 tggcgggcct gatgctcctg gtccatctgc tgatctactc ggccatccgg ccatacgtgc 421 gctttctgcc ctacgaggag ctgctggatt gccggatcaa tgtatcgaag tcgctggacc 481 tgggcgtccg tgtggtcggc caggtggcca actgcatcaa ccgctcggtg gccaccgctc 541 agttcctcct cctcggaacg gacctgcagg ccagcctcct gctgctgttc gtcctgatgg 601 aggtgcgcgc catcctctgc tggataaacc tctccacgct gattaagatc gcctactgtc 661 tggcgattgt tgttccaaaa ttgtgggagg ctttccttct ttggatggac tcacggggtt 721 taaataatcc ttacctgatc gcactcctga aggaagtttt cagcagggaa tttatttttg 781 agtgcctgga gcagctggcc atggaggtgc aactgtacag tgccaagtat tttgaactgg 841 aagcggagaa aacggaaccc gagggagcta atagtgggga aatccaggtg gcagatgtcg 901 ataccactgg cgatgagatg tcgatggaaa gtggcgagga aattcaagtg gcagtggtcg 961 ataggactgg ccaagactaa gaatcggcag actatcaaac gtatttggtt ttctttattt 1021 ctggttaaat atgttcaacg tttccattca atccaaatac acatactcaa aagacacaca 1081 ctacacatcg aagccaattg aaaccactga agttatagtt actaacaact tacgccataa 1141 aacacgataa aatataaata cactcattac acacaagaaa tt