Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii central complex broad (ccb),


LOCUS       XM_070219211            1182 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_070219211
VERSION     XM_070219211.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1182
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1182
                     /gene="ccb"
                     /note="central complex broad; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108055895"
     CDS             132..980
                     /gene="ccb"
                     /codon_start=1
                     /product="uncharacterized protein ccb"
                     /protein_id="XP_070075312.1"
                     /db_xref="GeneID:108055895"
                     /translation="MSIPENPEMNIEGEATLRAQRYTWDEFCGVVGGFAVPRFVWQLI
                     LCRDLRLSGLWLFLGLVVIDFLTSHSLPQLLGMAGLMLLVHLLIYSAIRPYVRFLPYE
                     ELLDCRINVSKSLDLGVRVVGQVANCINRSVATAQFLLLGTDLQASLLLLFVLMEVRA
                     ILCWINLSTLIKIAYCLAIVVPKLWEAFLLWMDSRGLNNPYLIALLKEVFSREFIFEC
                     LEQLAMEVQLYSAKYFELEAEKTEPEGANSGEIQVADVDTTGDEMSMESGEEIQVAVV
                     DRTGQD"
     misc_feature    <486..689
                     /gene="ccb"
                     /note="Region: Reticulon; pfam02453"
                     /db_xref="CDD:460562"
ORIGIN      
        1 cccacattca gcagtcagtt gacaattccc ttcagttata accagaactc cgtcgactca
       61 acaacgaaat cgaaaaatta tttattttcc tagtgcattt ttacttcaag aacttcattg
      121 gttgaacaat catgagtatt cccgagaatc cagagatgaa tatagagggg gaggcaactt
      181 tgcgagcaca gagatataca tgggatgagt tttgcggggt ggtgggcggc tttgccgtgc
      241 cccgcttcgt gtggcaattg atcctgtgcc gcgatctcag actcagtggc ctctggttgt
      301 tcctcggact cgtggtcatc gacttcctga ccagtcactc gctgccccag ctgctgggca
      361 tggcgggcct gatgctcctg gtccatctgc tgatctactc ggccatccgg ccatacgtgc
      421 gctttctgcc ctacgaggag ctgctggatt gccggatcaa tgtatcgaag tcgctggacc
      481 tgggcgtccg tgtggtcggc caggtggcca actgcatcaa ccgctcggtg gccaccgctc
      541 agttcctcct cctcggaacg gacctgcagg ccagcctcct gctgctgttc gtcctgatgg
      601 aggtgcgcgc catcctctgc tggataaacc tctccacgct gattaagatc gcctactgtc
      661 tggcgattgt tgttccaaaa ttgtgggagg ctttccttct ttggatggac tcacggggtt
      721 taaataatcc ttacctgatc gcactcctga aggaagtttt cagcagggaa tttatttttg
      781 agtgcctgga gcagctggcc atggaggtgc aactgtacag tgccaagtat tttgaactgg
      841 aagcggagaa aacggaaccc gagggagcta atagtgggga aatccaggtg gcagatgtcg
      901 ataccactgg cgatgagatg tcgatggaaa gtggcgagga aattcaagtg gcagtggtcg
      961 ataggactgg ccaagactaa gaatcggcag actatcaaac gtatttggtt ttctttattt
     1021 ctggttaaat atgttcaacg tttccattca atccaaatac acatactcaa aagacacaca
     1081 ctacacatcg aagccaattg aaaccactga agttatagtt actaacaact tacgccataa
     1141 aacacgataa aatataaata cactcattac acacaagaaa tt