Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii XK-related protein 6


LOCUS       XM_070219205             930 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058455), transcript variant X2, mRNA.
ACCESSION   XM_070219205
VERSION     XM_070219205.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..930
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..930
                     /gene="LOC108058455"
                     /note="XK-related protein 6; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108058455"
     CDS             150..824
                     /gene="LOC108058455"
                     /codon_start=1
                     /product="XK-related protein 6 isoform X2"
                     /protein_id="XP_070075306.1"
                     /db_xref="GeneID:108058455"
                     /translation="MESDERTQVDALMEPISRLSMLLTGFSIFWRFVSIFINWGLAYE
                     YWMEESYGYCAWTIGSIVLPMTVTSVIYIHTLKAGHSGEKRILERGLYSNVVISYLFR
                     DAYSLNYALKYTEAKRRDDQQEEIRYYQKLMTEECNVSFVRLFDSFLESAPQKILQLV
                     IVLRSIKDFTYYRLIAFVVYFGNIAWCIQAYNHSNRLVQLDKHDIAAKGRFLQFLFLL
                     CLTGIG"
     misc_feature    216..>776
                     /gene="LOC108058455"
                     /note="XK-related protein; Region: XK-related; pfam09815"
                     /db_xref="CDD:462912"
ORIGIN      
        1 taattttgga gacccactaa attctaaatt atttaaattt aatttagtag aattgatcgt
       61 aaaaagcaac tttccgggcg tcgtcagcta ccgaaatatg cggattatga tgtgtgcaat
      121 atcatagtgc ggagaaagcg aatgtcacga tggagtcaga cgaaagaacg caggtggacg
      181 ccctgatgga accgatctca agattgagta tgctgctcac tgggttctcg attttctggc
      241 ggttcgtttc cattttcatc aactggggcc tggcctacga gtattggatg gaggaatcct
      301 acggctactg tgcctggacg atcggctcga tcgtgctgcc catgacggtc acatcggtta
      361 tctatataca cactctaaaa gccggccatt cgggggagaa acgcatcctg gaaaggggat
      421 tatactcaaa tgtggtgatc tcgtacctct ttcgcgatgc ctactctctt aattatgcac
      481 tgaaatatac ggaggcgaaa aggcgggatg atcagcagga ggagatcaga tattatcaaa
      541 agcttatgac ggaagagtgc aatgtcagct ttgtccgcct tttcgattcg ttcttggaat
      601 ccgcaccgca gaaaatatta cagctcgtca tagtactgcg atcgatcaag gactttacat
      661 actatcgcct gatcgccttc gtcgtctact ttgggaacat agcgtggtgc atccaggcgt
      721 acaatcactc caatcgcctg gtgcagttgg acaaacatga tattgcggcc aagggacgat
      781 ttctgcaatt tctcttcctc ctctgtctca ctggcatagg ctaggcactg aatctaattg
      841 cgcatgcgca acgatcgtaa atggtcaagt atctggaacc agttggaatc ggaatcgtga
      901 tcggtctctg agccatggaa tttcgtatcg