Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219205 930 bp mRNA linear INV 09-DEC-2024 (LOC108058455), transcript variant X2, mRNA. ACCESSION XM_070219205 VERSION XM_070219205.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..930 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..930 /gene="LOC108058455" /note="XK-related protein 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058455" CDS 150..824 /gene="LOC108058455" /codon_start=1 /product="XK-related protein 6 isoform X2" /protein_id="XP_070075306.1" /db_xref="GeneID:108058455" /translation="MESDERTQVDALMEPISRLSMLLTGFSIFWRFVSIFINWGLAYE YWMEESYGYCAWTIGSIVLPMTVTSVIYIHTLKAGHSGEKRILERGLYSNVVISYLFR DAYSLNYALKYTEAKRRDDQQEEIRYYQKLMTEECNVSFVRLFDSFLESAPQKILQLV IVLRSIKDFTYYRLIAFVVYFGNIAWCIQAYNHSNRLVQLDKHDIAAKGRFLQFLFLL CLTGIG" misc_feature 216..>776 /gene="LOC108058455" /note="XK-related protein; Region: XK-related; pfam09815" /db_xref="CDD:462912" ORIGIN 1 taattttgga gacccactaa attctaaatt atttaaattt aatttagtag aattgatcgt 61 aaaaagcaac tttccgggcg tcgtcagcta ccgaaatatg cggattatga tgtgtgcaat 121 atcatagtgc ggagaaagcg aatgtcacga tggagtcaga cgaaagaacg caggtggacg 181 ccctgatgga accgatctca agattgagta tgctgctcac tgggttctcg attttctggc 241 ggttcgtttc cattttcatc aactggggcc tggcctacga gtattggatg gaggaatcct 301 acggctactg tgcctggacg atcggctcga tcgtgctgcc catgacggtc acatcggtta 361 tctatataca cactctaaaa gccggccatt cgggggagaa acgcatcctg gaaaggggat 421 tatactcaaa tgtggtgatc tcgtacctct ttcgcgatgc ctactctctt aattatgcac 481 tgaaatatac ggaggcgaaa aggcgggatg atcagcagga ggagatcaga tattatcaaa 541 agcttatgac ggaagagtgc aatgtcagct ttgtccgcct tttcgattcg ttcttggaat 601 ccgcaccgca gaaaatatta cagctcgtca tagtactgcg atcgatcaag gactttacat 661 actatcgcct gatcgccttc gtcgtctact ttgggaacat agcgtggtgc atccaggcgt 721 acaatcactc caatcgcctg gtgcagttgg acaaacatga tattgcggcc aagggacgat 781 ttctgcaatt tctcttcctc ctctgtctca ctggcatagg ctaggcactg aatctaattg 841 cgcatgcgca acgatcgtaa atggtcaagt atctggaacc agttggaatc ggaatcgtga 901 tcggtctctg agccatggaa tttcgtatcg