Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219203 667 bp mRNA linear INV 09-DEC-2024 (LOC108063832), transcript variant X3, mRNA. ACCESSION XM_070219203 VERSION XM_070219203.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..667 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..667 /gene="LOC108063832" /note="uncharacterized LOC108063832; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063832" CDS 150..566 /gene="LOC108063832" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070075304.1" /db_xref="GeneID:108063832" /translation="MCLILSLGCCGCSSPKPCHKNSKKQQQKQQQQEQHLQHQPKNYH SDIQLNELSPELSSINCQVTTSQPSLSPSLSPSLTALPHRIATSSTLSSWAGEEELCD MEDYDSRMPTRWTAWWLKGAAVEGDRKACHSTSIVS" polyA_site 667 /gene="LOC108063832" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgtgttgcc tcagttgaag gcacccagcg aagtgccgcg ggtaaatcga aataaataaa 61 aataaaaatt aacaacagac actctgccgc acttctgcta acatctatgg tacttttccg 121 atcttctcta cttcttttag tttcgaatca tgtgccttat cctctccctc ggctgctgcg 181 gctgctcctc cccgaagccc tgccacaaga acagcaagaa gcaacaacag aagcaacagc 241 agcaggagca gcacttgcag caccagccga agaactacca ctcggatatc cagctgaacg 301 agctatcgcc ggagctgtcc tcgatcaact gccaggtgac caccagtcag ccttcgctga 361 gtcccagcct cagtcccagt ttgacggctc tgccccacag gatcgccacg tcgagcaccc 421 tgagctcatg ggccggcgag gaggagctct gcgatatgga ggactacgac agtcgcatgc 481 ccacccgttg gacagcctgg tggctcaaag gtgccgccgt tgagggtgat aggaaggcct 541 gccactccac ctcgatcgta tcctaacttc gacctcctcg aacttcgagc caaaagaatt 601 cctgtttaat tgaaattaca ttaatacatt tatggaagtt ctcgaaaaaa cgataaagct 661 tttaaaa