Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219203             667 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063832), transcript variant X3, mRNA.
ACCESSION   XM_070219203
VERSION     XM_070219203.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..667
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..667
                     /gene="LOC108063832"
                     /note="uncharacterized LOC108063832; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108063832"
     CDS             150..566
                     /gene="LOC108063832"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070075304.1"
                     /db_xref="GeneID:108063832"
                     /translation="MCLILSLGCCGCSSPKPCHKNSKKQQQKQQQQEQHLQHQPKNYH
                     SDIQLNELSPELSSINCQVTTSQPSLSPSLSPSLTALPHRIATSSTLSSWAGEEELCD
                     MEDYDSRMPTRWTAWWLKGAAVEGDRKACHSTSIVS"
     polyA_site      667
                     /gene="LOC108063832"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgtgttgcc tcagttgaag gcacccagcg aagtgccgcg ggtaaatcga aataaataaa
       61 aataaaaatt aacaacagac actctgccgc acttctgcta acatctatgg tacttttccg
      121 atcttctcta cttcttttag tttcgaatca tgtgccttat cctctccctc ggctgctgcg
      181 gctgctcctc cccgaagccc tgccacaaga acagcaagaa gcaacaacag aagcaacagc
      241 agcaggagca gcacttgcag caccagccga agaactacca ctcggatatc cagctgaacg
      301 agctatcgcc ggagctgtcc tcgatcaact gccaggtgac caccagtcag ccttcgctga
      361 gtcccagcct cagtcccagt ttgacggctc tgccccacag gatcgccacg tcgagcaccc
      421 tgagctcatg ggccggcgag gaggagctct gcgatatgga ggactacgac agtcgcatgc
      481 ccacccgttg gacagcctgg tggctcaaag gtgccgccgt tgagggtgat aggaaggcct
      541 gccactccac ctcgatcgta tcctaacttc gacctcctcg aacttcgagc caaaagaatt
      601 cctgtttaat tgaaattaca ttaatacatt tatggaagtt ctcgaaaaaa cgataaagct
      661 tttaaaa