Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protamine-like protein 99C


LOCUS       XM_070219192             779 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062954), partial mRNA.
ACCESSION   XM_070219192
VERSION     XM_070219192.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..779
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            <1..779
                     /gene="LOC108062954"
                     /note="protamine-like protein 99C; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108062954"
     CDS             <1..669
                     /gene="LOC108062954"
                     /codon_start=1
                     /product="protamine-like protein 99C"
                     /protein_id="XP_070075293.1"
                     /db_xref="GeneID:108062954"
                     /translation="SANYEKKNPTLEAEDLLKKSTFSIRRNRLYTILEHLENKNLRVN
                     KKHIIEGKKRGKVHCEPVYKYQKVARLTRNGYLNILRDYKRLFCGILPQDMVRFGARQ
                     WNQLSLDEMKRFKTMGPSQKFESPSNKESTGESKRGKLCQKRLEGRERISSRSKKSQL
                     KKRDSNPLGSAIAYIHFMRKFQKKNPNLEAKDLLKKATHMWFRLQGHKRQQIESPLWI
                     VKTG"
     misc_feature    151..471
                     /gene="LOC108062954"
                     /note="Protamine and protamine like; Region:
                     Protamine_like; pfam06382"
                     /db_xref="CDD:283927"
     misc_feature    <517..>642
                     /gene="LOC108062954"
                     /note="Protamine and protamine like; Region:
                     Protamine_like; pfam06382"
                     /db_xref="CDD:283927"
ORIGIN      
        1 tctgcgaatt atgaaaaaaa gaatcccact ttggaggccg aggatctatt aaagaagtca
       61 actttctcaa tcagacgcaa tcgattgtac accattctgg aacatttaga gaacaaaaat
      121 ttaagggtta acaaaaaaca tataatcgag ggtaaaaagc gtggaaaagt acattgcgaa
      181 ccagtctaca agtaccagaa agtagctcgc cttactcgga atggctatct taacattttg
      241 agggactaca agaggctctt ctgcgggatt ttacctcaag atatggtacg ttttggggct
      301 aggcaatgga atcagctgtc cctcgatgaa atgaaacgct ttaaaactat ggggccatct
      361 caaaagttcg agagtccgtc taataaggaa agcactggtg aatctaaacg ggggaaacta
      421 tgtcaaaagc gcttggaggg aagggaaagg atctcatcaa gatcgaagaa gagtcagctt
      481 aagaaacgcg actcaaatcc tttgggctct gcgattgcct acattcattt catgcgcaag
      541 tttcagaaaa agaaccctaa tttggaggcc aaggatctat taaagaaggc aacccatatg
      601 tggttccgtc tacaaggaca taagcgccaa caaattgaaa gccctctttg gatcgtaaaa
      661 acaggatagg aagaaacact caatttctag caatattgaa atgtttaaat tttatgtgaa
      721 aagtattaga gtaataagga tttgtcaaat gttctgaaat aaaatttgta atttgtaaa