Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii zinc finger protein Paris


LOCUS       XM_070219184            1229 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056760), mRNA.
ACCESSION   XM_070219184
VERSION     XM_070219184.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1229
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1229
                     /gene="LOC108056760"
                     /note="zinc finger protein Paris; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056760"
     CDS             72..884
                     /gene="LOC108056760"
                     /codon_start=1
                     /product="zinc finger protein Paris"
                     /protein_id="XP_070075285.1"
                     /db_xref="GeneID:108056760"
                     /translation="MEAPLCRVCLEHGEIMVNVFDRTQDSGTCIANILSQWCGYPVKR
                     NDPFPKTICMSCLQDAEKAYETYDQIRENSLEDQGIAYSGNIIQVKEELVPDIWSYEE
                     AQENQLPCRVINEPLEEDVFEEEYFQISDSDFDGPVIEGEYYEDLAESTIKTKDFECP
                     QCPKTFPMECSLIKHLLTHGNRPVKFECPHCPRYFPLEWSLTKHLATHGERVFKCSLC
                     SAAFKNKETLKVHMRIHTGERPYKCSHCEMSFTTSSNLKRHLRTVHSSAKQR"
     misc_feature    84..290
                     /gene="LOC108056760"
                     /note="Zinc-finger associated domain (zf-AD); Region:
                     zf-AD; pfam07776"
                     /db_xref="CDD:462262"
     misc_feature    546..608
                     /gene="LOC108056760"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    633..695
                     /gene="LOC108056760"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(648..650,654..656,660..662,666..671,678..683,
                     690..692,729..731,735..737,747..752,759..764,771..773,
                     813..815,819..821,825..827,831..836,843..848,855..857)
                     /gene="LOC108056760"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    702..>881
                     /gene="LOC108056760"
                     /note="FOG: Zn-finger [General function prediction only];
                     Region: COG5048"
                     /db_xref="CDD:227381"
     misc_feature    714..776
                     /gene="LOC108056760"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    753..827
                     /gene="LOC108056760"
                     /note="Zinc-finger double domain; Region: zf-H2C2_2;
                     pfam13465"
                     /db_xref="CDD:463886"
     misc_feature    798..857
                     /gene="LOC108056760"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
        1 tgtaaacaaa ctaccctcga gcgatcgtaa atatttcgaa atttcctaat aatttgttcg
       61 atttcagggc tatggaggcg cccctgtgcc gtgtgtgcct ggagcacggc gaaatcatgg
      121 tgaatgtctt cgatcggacg caggactctg ggacttgcat tgccaacata ctttcccagt
      181 ggtgtgggta tcctgttaag aggaacgacc ccttccccaa aaccatttgc atgtcctgtc
      241 tgcaggatgc cgaaaaggcg tacgagacat acgatcagat acgagagaat tcactggagg
      301 atcaaggcat cgcatacagc ggtaatatca tccaggttaa ggaagaacta gtcccagata
      361 tttggagcta cgaagaagcc caggaaaatc agttgccatg tcgcgtgata aacgagcccc
      421 tggaggagga cgttttcgag gaggaatact ttcagatctc ggactcggac ttcgatggcc
      481 cagtaattga gggagaatat tatgaagacc ttgcggaatc gacgatcaaa acgaaagatt
      541 tcgagtgtcc gcaatgtcca aagacctttc caatggagtg cagtctcatc aagcacttgt
      601 tgacccacgg gaatcgaccg gtgaagttcg agtgtcccca ctgtcccagg tactttccac
      661 tggagtggag tctcaccaag cacttggcga cccacgggga acgggtgttt aagtgttctc
      721 tctgttcggc cgccttcaag aacaaggaga ctctcaaggt gcacatgcgc attcacaccg
      781 gagaacggcc ctacaagtgt tcccactgcg aaatgtcctt cacaaccagt tcgaacctca
      841 agcgacacct gcgaacggtg cattcttccg ccaagcaacg ttagcttgac cacactggaa
      901 tgcatccacc acatggttcg tcgctaggaa cttcaggtag agctgcaaaa aaaagatata
      961 cccgagttca gggacgcctc ccaatagact acttttgcaa cgtgatacca aaataagaca
     1021 gatactggat aatggaccat acaaactaac ggttatcgta cgtcttaata taaatgtagc
     1081 gtataatgtc attccatcct tcaattacca taatatttat agtaatatta taaaacatat
     1141 gaattggctt atgtacttaa tttttttttt ttttaaataa attcacactg tttaaggcac
     1201 tttacgaaaa taaatgatat tgcaccttc