Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219179 478 bp mRNA linear INV 09-DEC-2024 (LOC138913926), mRNA. ACCESSION XM_070219179 VERSION XM_070219179.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..478 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..478 /gene="LOC138913926" /note="uncharacterized LOC138913926; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:138913926" CDS 118..381 /gene="LOC138913926" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070075280.1" /db_xref="GeneID:138913926" /translation="MFNKSIVVALIVCACYLGTSDARPGLGELTSGPVGAALTGATTG MGAGAVSGLASSLTGGLTGANQGPLAPASAILASVANPTGLVG" polyA_site 478 /gene="LOC138913926" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctagatagtg atagccaata cgtgagctta gtccacgaaa gttttctggt cgggcactat 61 aaaaatcgga gccgattgag ttgggtcaag tagtcgatac atccgaaccg tgctaaaatg 121 ttcaacaaat cgatcgtcgt cgccctcatt gtgtgcgcct gctacctggg cactagtgat 181 gctcgtcctg gactcggcga gttgacttct gggccagtgg gagcagcatt gacaggagct 241 actactggaa tgggtgctgg agctgtttct ggacttgcta gttcacttac tggtggactt 301 actggtgcga accaaggacc tttggcacca gcttcagcaa ttttggcatc agttgcaaat 361 cctacaggac ttgttggcta aatcctacaa aaaaatgcaa aacccttaaa aaatgtttca 421 aaaaaattta ggataatttg tcaaaatttc aattgaaaat aaaataacct ttcgagca