Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219179             478 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913926), mRNA.
ACCESSION   XM_070219179
VERSION     XM_070219179.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..478
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..478
                     /gene="LOC138913926"
                     /note="uncharacterized LOC138913926; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:138913926"
     CDS             118..381
                     /gene="LOC138913926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070075280.1"
                     /db_xref="GeneID:138913926"
                     /translation="MFNKSIVVALIVCACYLGTSDARPGLGELTSGPVGAALTGATTG
                     MGAGAVSGLASSLTGGLTGANQGPLAPASAILASVANPTGLVG"
     polyA_site      478
                     /gene="LOC138913926"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctagatagtg atagccaata cgtgagctta gtccacgaaa gttttctggt cgggcactat
       61 aaaaatcgga gccgattgag ttgggtcaag tagtcgatac atccgaaccg tgctaaaatg
      121 ttcaacaaat cgatcgtcgt cgccctcatt gtgtgcgcct gctacctggg cactagtgat
      181 gctcgtcctg gactcggcga gttgacttct gggccagtgg gagcagcatt gacaggagct
      241 actactggaa tgggtgctgg agctgtttct ggacttgcta gttcacttac tggtggactt
      301 actggtgcga accaaggacc tttggcacca gcttcagcaa ttttggcatc agttgcaaat
      361 cctacaggac ttgttggcta aatcctacaa aaaaatgcaa aacccttaaa aaatgtttca
      421 aaaaaattta ggataatttg tcaaaatttc aattgaaaat aaaataacct ttcgagca