Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219178 1177 bp mRNA linear INV 09-DEC-2024 (LOC108056024), mRNA. ACCESSION XM_070219178 VERSION XM_070219178.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1177 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1177 /gene="LOC108056024" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056024" CDS 15..1043 /gene="LOC108056024" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_070075279.1" /db_xref="GeneID:108056024" /translation="MPSRLLSKCSSSVAAAAVLLFLIFNGQNGLTGAVTTRAPPPTRA PPPTRDPPPTRAPPPTRAPPPTRAPPPFTRIPRQSATDGYCVPSLCELYNGTHVVNVP HTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGQLEGYRSAAQMPL LRWDNELEQMAGLHAKRCQFAHDKCRNTPRFRFSGQNIGYFWIGREFKSHSRRMKSFV INWFREYLDANQSFIDSYRPHPQGKKIGHFTLLVSDRVSRVGCAGIRFLEPTTNRYQF MLTCNYDYNNIFNEPIYQSGPAGSKCVQHRISEKFPGLCDWRDPIGDAESEESAEDGN TLDNNIPL" misc_feature 402..863 /gene="LOC108056024" /note="Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Region: CAP_euk; cd05380" /db_xref="CDD:349399" polyA_site 1177 /gene="LOC108056024" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtcgaccgt cgagatgccg tcgagattgt tgagcaagtg cagcagcagc gtcgccgccg 61 ccgcagtgct cctttttttg attttcaatg gccaaaatgg attgacggga gctgtgacca 121 ccagggcgcc tccacctacc cgagctccac cacccactag ggatcctcca cccaccagag 181 ctccaccacc cactcgagct cctccaccga ctcgagctcc accgccgttc accaggattc 241 cgcggcaatc cgcgacggat ggctattgtg tgccctcact ttgtgagctc tacaatggaa 301 cgcatgtggt gaatgtgccc cataccgctt gcggcaacaa cggtagcttt tccccagcct 361 gcggaccgga acccaagcta ctggagatga gcgaaaggcg acgtcagctc ctgctcgata 421 tgcacaattt ggccagatca aagatcgcca gcggtcaact ggaaggctat cggagcgccg 481 cccaaatgcc cctcctccgt tgggacaacg aactggagca aatggccggg ctgcatgcca 541 aacgctgtca gtttgcccac gacaagtgcc gcaatacgcc gcgcttccgg ttcagcggcc 601 agaatatcgg ttacttttgg atcggtcgcg agttcaagtc gcattcgcgg cgcatgaaat 661 cctttgtgat taactggttc cgcgagtatc tggatgccaa ccagagcttc atcgacagct 721 atcgtccgca tccgcagggc aagaagattg gtcacttcac ccttttggtc tccgatcgcg 781 tgagtcgcgt gggctgcgcc ggcatccgct tcctggagcc cactaccaat cgctaccagt 841 tcatgctgac ttgtaattat gactacaaca acatattcaa cgaacccatt taccagtctg 901 gtccggcggg ttccaaatgc gttcagcacc ggatcagcga gaagttcccc ggtttatgcg 961 actggcgcga ccccatcggc gacgctgaaa gcgaggagag cgccgaggat ggcaacaccc 1021 tggataataa tatacccctg taaaggaata caaaccctaa gataaggaca aaatactcgt 1081 accacctgga ataagatata caaagcataa tttttttcat agtttttaag taaatatatt 1141 aaaatctttt aaaaagaatg gattgttatt gtgttaa