Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii antigen 5 like allergen Cul n 1


LOCUS       XM_070219178            1177 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056024), mRNA.
ACCESSION   XM_070219178
VERSION     XM_070219178.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1177
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1177
                     /gene="LOC108056024"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056024"
     CDS             15..1043
                     /gene="LOC108056024"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_070075279.1"
                     /db_xref="GeneID:108056024"
                     /translation="MPSRLLSKCSSSVAAAAVLLFLIFNGQNGLTGAVTTRAPPPTRA
                     PPPTRDPPPTRAPPPTRAPPPTRAPPPFTRIPRQSATDGYCVPSLCELYNGTHVVNVP
                     HTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGQLEGYRSAAQMPL
                     LRWDNELEQMAGLHAKRCQFAHDKCRNTPRFRFSGQNIGYFWIGREFKSHSRRMKSFV
                     INWFREYLDANQSFIDSYRPHPQGKKIGHFTLLVSDRVSRVGCAGIRFLEPTTNRYQF
                     MLTCNYDYNNIFNEPIYQSGPAGSKCVQHRISEKFPGLCDWRDPIGDAESEESAEDGN
                     TLDNNIPL"
     misc_feature    402..863
                     /gene="LOC108056024"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
     polyA_site      1177
                     /gene="LOC108056024"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgtcgaccgt cgagatgccg tcgagattgt tgagcaagtg cagcagcagc gtcgccgccg
       61 ccgcagtgct cctttttttg attttcaatg gccaaaatgg attgacggga gctgtgacca
      121 ccagggcgcc tccacctacc cgagctccac cacccactag ggatcctcca cccaccagag
      181 ctccaccacc cactcgagct cctccaccga ctcgagctcc accgccgttc accaggattc
      241 cgcggcaatc cgcgacggat ggctattgtg tgccctcact ttgtgagctc tacaatggaa
      301 cgcatgtggt gaatgtgccc cataccgctt gcggcaacaa cggtagcttt tccccagcct
      361 gcggaccgga acccaagcta ctggagatga gcgaaaggcg acgtcagctc ctgctcgata
      421 tgcacaattt ggccagatca aagatcgcca gcggtcaact ggaaggctat cggagcgccg
      481 cccaaatgcc cctcctccgt tgggacaacg aactggagca aatggccggg ctgcatgcca
      541 aacgctgtca gtttgcccac gacaagtgcc gcaatacgcc gcgcttccgg ttcagcggcc
      601 agaatatcgg ttacttttgg atcggtcgcg agttcaagtc gcattcgcgg cgcatgaaat
      661 cctttgtgat taactggttc cgcgagtatc tggatgccaa ccagagcttc atcgacagct
      721 atcgtccgca tccgcagggc aagaagattg gtcacttcac ccttttggtc tccgatcgcg
      781 tgagtcgcgt gggctgcgcc ggcatccgct tcctggagcc cactaccaat cgctaccagt
      841 tcatgctgac ttgtaattat gactacaaca acatattcaa cgaacccatt taccagtctg
      901 gtccggcggg ttccaaatgc gttcagcacc ggatcagcga gaagttcccc ggtttatgcg
      961 actggcgcga ccccatcggc gacgctgaaa gcgaggagag cgccgaggat ggcaacaccc
     1021 tggataataa tatacccctg taaaggaata caaaccctaa gataaggaca aaatactcgt
     1081 accacctgga ataagatata caaagcataa tttttttcat agtttttaag taaatatatt
     1141 aaaatctttt aaaaagaatg gattgttatt gtgttaa