PREDICTED: Drosophila takahashii sn-1-specific diacylglycerol

LOCUS       XM_070219167             719 bp    mRNA    linear   INV 09-DEC-2024
            lipase ABHD11 (LOC108060284), transcript variant X2, mRNA.
ACCESSION   XM_070219167
VERSION     XM_070219167.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..719
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..719
                     /gene="LOC108060284"
                     /note="sn-1-specific diacylglycerol lipase ABHD11; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:108060284"
     CDS             94..639
                     /gene="LOC108060284"
                     /codon_start=1
                     /product="sn-1-specific diacylglycerol lipase ABHD11
                     isoform X2"
                     /protein_id="XP_070075268.1"
                     /db_xref="GeneID:108060284"
                     /translation="MMTAGFYSKTIPKPELVERLIVVDISPISVPRSTGEMTQIFDAM
                     VSLDLSPTLSMSEGRKIAREKLLKATEDETVDFIMLNLRKDPKTGVFSWACNARVLRD
                     FLTRFDNYQSNLEKLPPYTGPTTFICGSRSPYMRREQWPQIVEMFPNSEIHWLEAGHL
                     VHFEQPQEFLTLVSEFLNRSD"
     misc_feature    <307..633
                     /gene="LOC108060284"
                     /note="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase MenH and related
                     esterases, alpha/beta hydrolase fold [Coenzyme transport
                     and metabolism, General function prediction only]; Region:
                     MenH; COG0596"
                     /db_xref="CDD:440361"
     polyA_site      719
                     /gene="LOC108060284"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgcgtctgtt tctggagcag cggcagcacc cgaaggccgc ctgcttggga cacagcatgg
       61 gtggcaggtc catgatgtac ttcgcccgga aatatgatga ctgcaggatt ttattctaaa
      121 acaataccca agcccgagtt ggtggagcgc ttaatagtgg tggatatatc gcccataagc
      181 gtgccccgtt ccactggaga gatgacgcaa atcttcgatg cgatggtctc tttggatctc
      241 tcaccgacac tgtccatgtc cgagggccgg aaaatcgcaa gggaaaaact actaaaggcc
      301 accgaggacg agaccgtgga ctttatcatg ctgaatctcc gaaaggatcc aaagacgggg
      361 gtattctcat gggcctgcaa tgcccgggta cttcgagatt tcctcacccg cttcgataat
      421 taccaaagca atctggagaa actgccgccg tacacgggac ccaccacttt tatctgcgga
      481 tcgcggtcac cttacatgag acgcgaacag tggccgcaga ttgtggagat gttccccaat
      541 tcggagatcc actggctgga agccgggcat ctggtgcatt tcgagcagcc tcaagagttc
      601 cttacattag tcagcgagtt cctgaacaga tctgattaga ccaaattcga tatgttagcc
      661 aattgtacaa aggagtcaat aatagataga ctttagctaa attaaaaatg ttaataaaa