Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii hayan (Hayan), transcript variant


LOCUS       XM_070219166            1537 bp    mRNA    linear   INV 09-DEC-2024
            X5, mRNA.
ACCESSION   XM_070219166
VERSION     XM_070219166.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1537
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1537
                     /gene="Hayan"
                     /note="hayan; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:108061002"
     CDS             357..1499
                     /gene="Hayan"
                     /codon_start=1
                     /product="serine protease Hayan isoform X4"
                     /protein_id="XP_070075267.1"
                     /db_xref="GeneID:108061002"
                     /translation="MISARSCLLLGLLALTNSGRLAVGDEGDPCQVKADIPGICRPSS
                     GCNNIEGYLKSGALSTNQVPSCGFGAREEIICCPTVACCPTDTTTTTTTPSPSPSRVN
                     VPDQERPAAAACARIRSGDRPLTPHILGGIPVALGVYPHMAAIAYNTFDTVDFRCGGS
                     LIASRFVLTAAHCVNSDSTTPAFVRLGTVAIENPTAGFQDINVIDVQIHPNYTSSSKY
                     NDIAILELAEDAKESDTIRPACLYIDRAGPPIDSKVFVAGWGVMNVTNRARSKILLRA
                     GLDLVPVDECNASFAEQPSTIRALKQGVIDSLLCAADKKQVKDACQGDSGGPLILETD
                     EVDGLYSVLGVINSGFGCATKTPGLYTRVSSFLDYIEGIVWPANRV"
     misc_feature    444..590
                     /gene="Hayan"
                     /note="Clip or disulphide knot domain; Region: CLIP;
                     smart00680"
                     /db_xref="CDD:197829"
     misc_feature    735..1466
                     /gene="Hayan"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    738..740
                     /gene="Hayan"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(870..872,1014..1016,1329..1331)
                     /gene="Hayan"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1311..1313,1395..1397,1401..1403)
                     /gene="Hayan"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1537
                     /gene="Hayan"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttgcttggg cgatgcgttg ctgagcggtc atagccccac tatatactat atagcctatt
       61 ccgccgattc cgaatccgaa tccgattccg cgatagccac cggttttcag ctttattggc
      121 tctgctggtg tgcttttttg ctgtgtgttt ttttttgttt tgtgattttt atttactttt
      181 tttttatttt gtgttgtctt atttttcgat gtagtgttgt gttgtatttt attgttcagt
      241 gccgcccgat tgccgttttc atagtgcccg acgcactcaa taaacatcaa cgtatacgta
      301 tcatacgtat tcccttatca gagaccgaaa aaaggtcgtg tcaaagctga ctgaagatga
      361 tctcggcgag aagctgcctc cttctgggcc ttctggcact gacaaactcc ggccgactag
      421 cagttgggga tgagggcgat ccgtgccagg tgaaggcgga cattccgggc atttgccggc
      481 catcctcggg ttgtaacaat atcgagggat acctcaagtc gggggccctg tccaccaatc
      541 aagtgccgag ctgcggcttt ggggcgcgcg aggagatcat ctgctgcccc accgtcgcct
      601 gctgtcccac tgatacgacg acgacgacga cgacgcccag ccccagtcct tcgcgcgtca
      661 atgtcccgga ccaggagcga ccagcggcgg cagcctgtgc gaggatccgg tccggcgaca
      721 ggcccttaac gcctcacatc ctgggcggca taccggtggc tctgggcgtc tatccccaca
      781 tggcggccat cgcatacaac accttcgata cagtggactt ccgctgtggc ggatcgctca
      841 tcgccagtcg cttcgtcctc acagctgccc actgcgtgaa tagtgatagc acaacgccgg
      901 ccttcgtccg cttgggtacg gtggccatcg agaatcccac ggcgggcttc caggacatca
      961 atgtgattga cgtccagatt cacccgaact atacgagcag tagtaaatac aatgatatcg
     1021 ccattttgga actggcggag gatgccaagg agtcggacac cattcgtcct gcctgtctgt
     1081 acattgatcg cgcaggtcct cccattgact ccaaagtttt cgtcgccggt tggggcgtta
     1141 tgaatgtgac caatcgcgcc aggtcaaaga tcctgctgcg tgctggcctg gatctggtgc
     1201 ccgtggacga gtgcaacgcc tccttcgccg aacagcccag caccattcgg gccttgaagc
     1261 agggcgtcat cgattcgctg ctgtgcgcgg cggacaagaa gcaggtgaag gacgcctgcc
     1321 agggcgattc cggtggtccg ctcatcctcg aaacggacga ggtggacggc ctctactcgg
     1381 tcctgggcgt aatcaactcg ggtttcggct gcgccaccaa aacaccgggc ctctatacgc
     1441 gagtcagctc cttcctcgac tatatcgagg gtattgtgtg gcccgctaac cgggtgtgat
     1501 tagacttttg atctgcaata aatttagttt gaacgga