Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219166 1537 bp mRNA linear INV 09-DEC-2024 X5, mRNA. ACCESSION XM_070219166 VERSION XM_070219166.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1537 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1537 /gene="Hayan" /note="hayan; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108061002" CDS 357..1499 /gene="Hayan" /codon_start=1 /product="serine protease Hayan isoform X4" /protein_id="XP_070075267.1" /db_xref="GeneID:108061002" /translation="MISARSCLLLGLLALTNSGRLAVGDEGDPCQVKADIPGICRPSS GCNNIEGYLKSGALSTNQVPSCGFGAREEIICCPTVACCPTDTTTTTTTPSPSPSRVN VPDQERPAAAACARIRSGDRPLTPHILGGIPVALGVYPHMAAIAYNTFDTVDFRCGGS LIASRFVLTAAHCVNSDSTTPAFVRLGTVAIENPTAGFQDINVIDVQIHPNYTSSSKY NDIAILELAEDAKESDTIRPACLYIDRAGPPIDSKVFVAGWGVMNVTNRARSKILLRA GLDLVPVDECNASFAEQPSTIRALKQGVIDSLLCAADKKQVKDACQGDSGGPLILETD EVDGLYSVLGVINSGFGCATKTPGLYTRVSSFLDYIEGIVWPANRV" misc_feature 444..590 /gene="Hayan" /note="Clip or disulphide knot domain; Region: CLIP; smart00680" /db_xref="CDD:197829" misc_feature 735..1466 /gene="Hayan" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 738..740 /gene="Hayan" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(870..872,1014..1016,1329..1331) /gene="Hayan" /note="active site" /db_xref="CDD:238113" misc_feature order(1311..1313,1395..1397,1401..1403) /gene="Hayan" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 1537 /gene="Hayan" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttgcttggg cgatgcgttg ctgagcggtc atagccccac tatatactat atagcctatt 61 ccgccgattc cgaatccgaa tccgattccg cgatagccac cggttttcag ctttattggc 121 tctgctggtg tgcttttttg ctgtgtgttt ttttttgttt tgtgattttt atttactttt 181 tttttatttt gtgttgtctt atttttcgat gtagtgttgt gttgtatttt attgttcagt 241 gccgcccgat tgccgttttc atagtgcccg acgcactcaa taaacatcaa cgtatacgta 301 tcatacgtat tcccttatca gagaccgaaa aaaggtcgtg tcaaagctga ctgaagatga 361 tctcggcgag aagctgcctc cttctgggcc ttctggcact gacaaactcc ggccgactag 421 cagttgggga tgagggcgat ccgtgccagg tgaaggcgga cattccgggc atttgccggc 481 catcctcggg ttgtaacaat atcgagggat acctcaagtc gggggccctg tccaccaatc 541 aagtgccgag ctgcggcttt ggggcgcgcg aggagatcat ctgctgcccc accgtcgcct 601 gctgtcccac tgatacgacg acgacgacga cgacgcccag ccccagtcct tcgcgcgtca 661 atgtcccgga ccaggagcga ccagcggcgg cagcctgtgc gaggatccgg tccggcgaca 721 ggcccttaac gcctcacatc ctgggcggca taccggtggc tctgggcgtc tatccccaca 781 tggcggccat cgcatacaac accttcgata cagtggactt ccgctgtggc ggatcgctca 841 tcgccagtcg cttcgtcctc acagctgccc actgcgtgaa tagtgatagc acaacgccgg 901 ccttcgtccg cttgggtacg gtggccatcg agaatcccac ggcgggcttc caggacatca 961 atgtgattga cgtccagatt cacccgaact atacgagcag tagtaaatac aatgatatcg 1021 ccattttgga actggcggag gatgccaagg agtcggacac cattcgtcct gcctgtctgt 1081 acattgatcg cgcaggtcct cccattgact ccaaagtttt cgtcgccggt tggggcgtta 1141 tgaatgtgac caatcgcgcc aggtcaaaga tcctgctgcg tgctggcctg gatctggtgc 1201 ccgtggacga gtgcaacgcc tccttcgccg aacagcccag caccattcgg gccttgaagc 1261 agggcgtcat cgattcgctg ctgtgcgcgg cggacaagaa gcaggtgaag gacgcctgcc 1321 agggcgattc cggtggtccg ctcatcctcg aaacggacga ggtggacggc ctctactcgg 1381 tcctgggcgt aatcaactcg ggtttcggct gcgccaccaa aacaccgggc ctctatacgc 1441 gagtcagctc cttcctcgac tatatcgagg gtattgtgtg gcccgctaac cgggtgtgat 1501 tagacttttg atctgcaata aatttagttt gaacgga