Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219158 1091 bp mRNA linear INV 09-DEC-2024 (Prosbeta2R1), transcript variant X2, mRNA. ACCESSION XM_070219158 VERSION XM_070219158.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1091 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1091 /gene="Prosbeta2R1" /note="Proteasome beta2 subunit-related 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065544" CDS 342..1007 /gene="Prosbeta2R1" /codon_start=1 /product="proteasome subunit beta type-7 isoform X2" /protein_id="XP_070075259.1" /db_xref="GeneID:108065544" /translation="MMTLMTSSELDMHQLNTGRQVPVVCASMLLRRTLFRYQGHIGAA LVMGGVDRTGPQIYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWRPDLDREQGKQLV REAISAGVFNDLGSGSNIDLCVITRKGAEYLRTDTIASEKGERLGKYGIRPNTTMVTS TSVLSLLVTDERTYGVGSFPSQFSVVADQDQQPGTSGVQGGNPSKEEEEEDLPGGSQK KSL" misc_feature <342..746 /gene="Prosbeta2R1" /note="The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid. N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a...; Region: Ntn_hydrolase; cl00467" /db_xref="CDD:469781" misc_feature 756..860 /gene="Prosbeta2R1" /note="Proteasome beta subunits C terminal; Region: Pr_beta_C; pfam12465" /db_xref="CDD:463597" ORIGIN 1 ataaaacttg gtgatttttc attgtacatt ttacacacca tgcttttccc gttttccgct 61 ccaaaagcgg ctcaggaaaa gtccgtggat atttctggaa tgcgctgcgg attcaatttt 121 gtcaattaaa tgctgagcta ttggcccagg gctatgagcc accgaaagcg attcgcacgg 181 gcacctccat tgtggggatt atctataagg atggcgttat cctgggcgcc gacactcgcg 241 ccaccgaagg acccattgtt tccgacaaga actgctcgaa aattcaccac ctccagaatc 301 acatttattg ctgtggagcc ggaaccgctg ccgacactga aatgatgacc ctgatgacct 361 cctcggagct tgatatgcac cagctgaaca ccgggcggca ggtgccggtg gtctgtgcca 421 gcatgctgct ccgccggacc ctcttccgct accagggaca catcggggcc gccctggtga 481 tgggcggcgt ggacaggacg ggtccgcaga tctactgcat ctatccgtgc ggatccaacg 541 acaagatacc ctatgcggcc atgggctcgg gtaccctggc ggcgatgtcc gtgctggagc 601 acggctggcg acccgacttg gaccgggagc agggcaagca gctggtccgc gaggccatct 661 cggcgggggt gttcaacgat ctgggctccg gctcgaatat cgatctctgc gtgatcacca 721 gaaaaggggc ggagtacctg aggacggaca cgattgccag cgagaagggc gagaggttgg 781 gaaaatacgg cataagaccc aacaccacaa tggtgacctc cacgtcggtg ctgagtctac 841 tggtcaccga tgagcgaacc tacggcgtgg gttcgtttcc ctcgcaattc tcggtggtgg 901 cggatcagga tcagcagccg ggcaccagtg gcgtccaggg tggtaatccc agcaaggagg 961 aggaggagga ggacctgccc ggtggatccc agaaaaaatc actgtaaccc cgtatttccc 1021 atttccattt gaattctagc aaattaaccg ttaacaagcc acttgactct acacataaat 1081 gtaaaaatgc a