Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Proteasome beta2 subunit-related 1


LOCUS       XM_070219158            1091 bp    mRNA    linear   INV 09-DEC-2024
            (Prosbeta2R1), transcript variant X2, mRNA.
ACCESSION   XM_070219158
VERSION     XM_070219158.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1091
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1091
                     /gene="Prosbeta2R1"
                     /note="Proteasome beta2 subunit-related 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108065544"
     CDS             342..1007
                     /gene="Prosbeta2R1"
                     /codon_start=1
                     /product="proteasome subunit beta type-7 isoform X2"
                     /protein_id="XP_070075259.1"
                     /db_xref="GeneID:108065544"
                     /translation="MMTLMTSSELDMHQLNTGRQVPVVCASMLLRRTLFRYQGHIGAA
                     LVMGGVDRTGPQIYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWRPDLDREQGKQLV
                     REAISAGVFNDLGSGSNIDLCVITRKGAEYLRTDTIASEKGERLGKYGIRPNTTMVTS
                     TSVLSLLVTDERTYGVGSFPSQFSVVADQDQQPGTSGVQGGNPSKEEEEEDLPGGSQK
                     KSL"
     misc_feature    <342..746
                     /gene="Prosbeta2R1"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
     misc_feature    756..860
                     /gene="Prosbeta2R1"
                     /note="Proteasome beta subunits C terminal; Region:
                     Pr_beta_C; pfam12465"
                     /db_xref="CDD:463597"
ORIGIN      
        1 ataaaacttg gtgatttttc attgtacatt ttacacacca tgcttttccc gttttccgct
       61 ccaaaagcgg ctcaggaaaa gtccgtggat atttctggaa tgcgctgcgg attcaatttt
      121 gtcaattaaa tgctgagcta ttggcccagg gctatgagcc accgaaagcg attcgcacgg
      181 gcacctccat tgtggggatt atctataagg atggcgttat cctgggcgcc gacactcgcg
      241 ccaccgaagg acccattgtt tccgacaaga actgctcgaa aattcaccac ctccagaatc
      301 acatttattg ctgtggagcc ggaaccgctg ccgacactga aatgatgacc ctgatgacct
      361 cctcggagct tgatatgcac cagctgaaca ccgggcggca ggtgccggtg gtctgtgcca
      421 gcatgctgct ccgccggacc ctcttccgct accagggaca catcggggcc gccctggtga
      481 tgggcggcgt ggacaggacg ggtccgcaga tctactgcat ctatccgtgc ggatccaacg
      541 acaagatacc ctatgcggcc atgggctcgg gtaccctggc ggcgatgtcc gtgctggagc
      601 acggctggcg acccgacttg gaccgggagc agggcaagca gctggtccgc gaggccatct
      661 cggcgggggt gttcaacgat ctgggctccg gctcgaatat cgatctctgc gtgatcacca
      721 gaaaaggggc ggagtacctg aggacggaca cgattgccag cgagaagggc gagaggttgg
      781 gaaaatacgg cataagaccc aacaccacaa tggtgacctc cacgtcggtg ctgagtctac
      841 tggtcaccga tgagcgaacc tacggcgtgg gttcgtttcc ctcgcaattc tcggtggtgg
      901 cggatcagga tcagcagccg ggcaccagtg gcgtccaggg tggtaatccc agcaaggagg
      961 aggaggagga ggacctgccc ggtggatccc agaaaaaatc actgtaaccc cgtatttccc
     1021 atttccattt gaattctagc aaattaaccg ttaacaagcc acttgactct acacataaat
     1081 gtaaaaatgc a