Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219155 1413 bp mRNA linear INV 09-DEC-2024 variant X2, mRNA. ACCESSION XM_070219155 VERSION XM_070219155.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1413 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1413 /gene="Sirt4" /note="Sirtuin 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108058381" CDS 83..1021 /gene="Sirt4" /codon_start=1 /product="NAD-dependent protein deacylase Sirt4" /protein_id="XP_070075256.1" /db_xref="GeneID:108058381" /translation="MRVGQLLRFRSTAFRGSTARQEYVPHHKPVVEDDIKRLEDFLMS KPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFV GWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHSKAGSRNVVEVHGSGYVVKC LSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFQIPECTQCGGDL KPEIVFFGDSVPRSRLDEIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVAIV NIGDTRADHLADIKISAKCGDVIPKLFDFRSSKRAS" misc_feature 194..979 /gene="Sirt4" /note="Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone...; Region: SIRT4; cd01409" /db_xref="CDD:238700" misc_feature order(245..247,251..256,275..280,428..430,482..487, 491..493,536..538,833..835,848..850,914..919,974..976) /gene="Sirt4" /note="NAD+ binding site [chemical binding]; other site" /db_xref="CDD:238700" misc_feature order(488..490,536..538,749..751,755..769,845..853) /gene="Sirt4" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:238700" misc_feature order(560..562,569..571,713..715,722..724) /gene="Sirt4" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:238700" ORIGIN 1 gatactatcg ttagtggctg gcccagctct agtaacgtaa tcagtaaaat aaattttaat 61 aataaaacaa tacataacaa atatgcgggt gggtcaactg ctccggttcc gaagcaccgc 121 cttccggggc tccaccgcta ggcaagagta cgtgccacat cataaacccg tcgtggagga 181 tgacatcaaa cggttggaag acttcctgat gtccaaaccg aatgttttgg ttctgacagg 241 tgctgggatc tcaactgaat cgggaattcc cgactaccgc tccgagggcg tgggactcta 301 cgcccgttcc aatcacaagc ccgtgcagca catggagttc gtcaagtcgt cggcggtgcg 361 caagcgctac tgggccagga acttcgtggg ctggcccaag ttctccgcca ctcagcccaa 421 tgccacgcat catgctctgg ccagattcga gcgggaggag cgagtgcagg cggtggtcac 481 ccagaatgtg gatcgtctgc actcgaaggc cggcagccgc aatgtggtcg aggtccatgg 541 cagtggctat gtggtcaagt gcttatcctg cgaataccgc atcgatcgtc atgagttcca 601 gagcatcctg gcctccctca atccggcctt caaggacgcc cccgacatga tccggcccga 661 cggcgatgtg gagatccccc tggagtatat agagaacttc cagatccctg agtgcacgca 721 gtgtggtggc gacttgaagc ccgaaattgt cttcttcggg gactctgtac cgagatcccg 781 actggatgaa atcgcaggca tggtctacaa tagcgatggc ctgttggtcc tgggctccag 841 tctcttggtc ttctccggct accgcgttgt cctgcagaca aaggacctca agctaccggt 901 ggccatagtc aatataggcg acacgcgtgc cgaccacctg gcggacatca agatatccgc 961 caagtgcggc gatgtgatac caaaattgtt cgattttcgc tcctcgaaac gcgccagcta 1021 gtcctggctc ctccttgttg tatatatcat aactcataaa tttattaatg gctttaatac 1081 gttgagaaca aagagaaaca aataacatga aatcataaca gattagcaac gtttttttaa 1141 gcttaaatca tttattgtta cagatttacc attttcattt caatatcata tcatatattt 1201 acaagaaatt ggaattgttt gaaagtctaa attgccaaat ttgagaaact atttaaaaat 1261 attttcaaat attttggaaa atataaataa aaaaaataaa atgattgtaa aaaatgtaac 1321 taatgtatta ttttaaaatt gtgcttatct ttaaaaaaat ttcaggaata tggcaacacg 1381 attgcatcaa ttaaaaaaac agttggcaat acc