Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219154             792 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060294), transcript variant X2, mRNA.
ACCESSION   XM_070219154
VERSION     XM_070219154.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..792
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..792
                     /gene="LOC108060294"
                     /note="uncharacterized LOC108060294; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108060294"
     CDS             85..675
                     /gene="LOC108060294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070075255.1"
                     /db_xref="GeneID:108060294"
                     /translation="MFPVKQRSFVMVGVRSFRLGFNYKLMNRTKGCDKTSATVLTSHL
                     SGDRKTELLPEEPRKPEDLLQHLGPQRNELEQRKIRKAQYESHLKELLHQRPSDSELA
                     IQCVPFVKTTTGPENPLKRRYDSPESLLEQVSDPKELAKEIIKLARELHTERQKNEIV
                     MQNFLDLEETLFLKNSASNSAPKKTNNNPDDGKKTK"
     polyA_site      792
                     /gene="LOC108060294"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aagcactagt tttggtagag aacaaaaata tataagattt ttacttgtga ataaatattt
       61 tttttctttt tgtgtctggc aagaatgttt cccgtgaagc aaaggtcctt cgtaatggtt
      121 ggagtgcgat ccttccgttt gggcttcaat tacaagctga tgaatcgcac caagggctgt
      181 gacaagacct cggctactgt gctcactagt catctgtccg gggatcgaaa gacggagctg
      241 ctgcccgagg agccgcgcaa accggaggat ctgctgcagc atttgggccc ccagcgcaat
      301 gaactcgaac agcgaaagat ccggaaggcc cagtacgagt cgcatttgaa ggagctgctc
      361 caccaaagac cctccgactc ggagttggcc atccagtgcg tgcccttcgt caagaccaca
      421 actggcccgg aaaatcccct gaagcggcgt tacgatagtc ccgaatcgct gctcgaacag
      481 gtcagtgatc ccaaggaatt ggccaaggag atcatcaaat tggcccgcga gttgcacacc
      541 gaacggcaga agaacgagat tgttatgcaa aatttcctag atctggagga aactttgttt
      601 ctcaagaatt cggcttcgaa ctcggcaccc aagaaaacaa acaataatcc cgatgatggc
      661 aagaaaacca agtgaaagct gcagtttcgg aataatttgc gtgttttctt catttcattt
      721 aaaatttttt gtacattttg gccaccctga taatgtttct ataatataat tcatatttcg
      781 gtaacaaaag aa