Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219154 792 bp mRNA linear INV 09-DEC-2024 (LOC108060294), transcript variant X2, mRNA. ACCESSION XM_070219154 VERSION XM_070219154.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..792 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..792 /gene="LOC108060294" /note="uncharacterized LOC108060294; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060294" CDS 85..675 /gene="LOC108060294" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070075255.1" /db_xref="GeneID:108060294" /translation="MFPVKQRSFVMVGVRSFRLGFNYKLMNRTKGCDKTSATVLTSHL SGDRKTELLPEEPRKPEDLLQHLGPQRNELEQRKIRKAQYESHLKELLHQRPSDSELA IQCVPFVKTTTGPENPLKRRYDSPESLLEQVSDPKELAKEIIKLARELHTERQKNEIV MQNFLDLEETLFLKNSASNSAPKKTNNNPDDGKKTK" polyA_site 792 /gene="LOC108060294" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aagcactagt tttggtagag aacaaaaata tataagattt ttacttgtga ataaatattt 61 tttttctttt tgtgtctggc aagaatgttt cccgtgaagc aaaggtcctt cgtaatggtt 121 ggagtgcgat ccttccgttt gggcttcaat tacaagctga tgaatcgcac caagggctgt 181 gacaagacct cggctactgt gctcactagt catctgtccg gggatcgaaa gacggagctg 241 ctgcccgagg agccgcgcaa accggaggat ctgctgcagc atttgggccc ccagcgcaat 301 gaactcgaac agcgaaagat ccggaaggcc cagtacgagt cgcatttgaa ggagctgctc 361 caccaaagac cctccgactc ggagttggcc atccagtgcg tgcccttcgt caagaccaca 421 actggcccgg aaaatcccct gaagcggcgt tacgatagtc ccgaatcgct gctcgaacag 481 gtcagtgatc ccaaggaatt ggccaaggag atcatcaaat tggcccgcga gttgcacacc 541 gaacggcaga agaacgagat tgttatgcaa aatttcctag atctggagga aactttgttt 601 ctcaagaatt cggcttcgaa ctcggcaccc aagaaaacaa acaataatcc cgatgatggc 661 aagaaaacca agtgaaagct gcagtttcgg aataatttgc gtgttttctt catttcattt 721 aaaatttttt gtacattttg gccaccctga taatgtttct ataatataat tcatatttcg 781 gtaacaaaag aa