Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219145 1480 bp mRNA linear INV 09-DEC-2024 (Rab27), transcript variant X2, mRNA. ACCESSION XM_070219145 VERSION XM_070219145.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1480 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1480 /gene="Rab27" /note="RAS oncogene family member Rab27; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063801" CDS 712..1407 /gene="Rab27" /codon_start=1 /product="ras-related protein Rab-27A" /protein_id="XP_070075246.1" /db_xref="GeneID:108063801" /translation="MTGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKS FLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSA CTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPDDLLRLHERR EEAPQRRGNCRNC" misc_feature 733..1254 /gene="Rab27" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 763..786 /gene="Rab27" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature order(769..789,928..930,1096..1101,1105..1107,1186..1194) /gene="Rab27" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206648" misc_feature 838..840 /gene="Rab27" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 850..858 /gene="Rab27" /note="Switch I region; other site" /db_xref="CDD:206648" misc_feature 919..930 /gene="Rab27" /note="G3 box; other site" /db_xref="CDD:206648" misc_feature order(925..930,976..981) /gene="Rab27" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 1096..1107 /gene="Rab27" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 1186..1194 /gene="Rab27" /note="G5 box; other site" /db_xref="CDD:206648" ORIGIN 1 atatttaact tattaaaaca tggcaagcca tatttatcac ttaactatgt ttaaaaattg 61 ttaaaatctt catttcaaaa taaagcagtt atcgttttca ctggcaaaat ttcttacact 121 ttatatcaat ttcaaattga aggtccaaag ctcctttcaa agctttctcc caaaggaaaa 181 gatgttcgct aaacgggaaa accccttcaa agtcctttca aagtccccgt gcaagttttg 241 gctgaaagct gcgcttcagt tggcggccaa atggcaggat tacacaggtt gcaggatagt 301 ccgtgctggg cagcgcatgg caacaggtcg ggcagcgcat cgcccgcatc cggagccaca 361 tcctcggaat ctcaatctga atcgagattc agtcgagtcg agtttgtttt cgttttggca 421 gcaaatcatc gaaagtcggg ggaacgaact cccgggcaga cgaattgcgc gcgctaaaaa 481 taacggttgc ccgcctaatc cttcaatcct ccaagcctcc aatcctccag catccttcat 541 ccttcatcct tggagtgccg aaaccccgtt tttttttggc gggcgttggg gcggaaatgc 601 gtgccgcgcc tctgcaatta gcaattagcc ggatccggtg agcaggcgga caagatgcgt 661 ccgctgtcct gaactcagag caaccagaga atcagagaac cagaagccag aatgacgggc 721 gccaatatcg actacgacta cctgctcaag ttcctggtcc tcggggactc cggcgtgggc 781 aaaacctgcc tgctctacca gtacacggac ggccggttcc acacccagtt catctccacc 841 gtgggcatcg acttccgcga gaagcgactg ttgtacaact cccgcgggcg gcggcaccgc 901 atccacctgc agatctggga caccgccggc caggagcgct tccggtcgct gacgacggcc 961 ttctaccggg acgccatggg cttcctgctg atcttcgacc tgaccagcga gaagagcttc 1021 ctggagacgg ccaactggct gtcgcagctg cggacgcacg cctactcgga ggaccccgac 1081 gtggtgctct gcggcaacaa gtgcgacctg ctgcagctgc gcgtggtgag ccgcgaccag 1141 gtggcggcgc tctgccggcg ctaccggctg ccctacatcg agacgagcgc ctgcaccggg 1201 gcgaatgtga aggaggccgt cgagctgctc gtgggccgcg tcatggagcg gatcgagaac 1261 gcggcctgca accgggagtt ctccctgctg ctcacccagt cgcgctgcct cccgaacatc 1321 gcctacgggc agccggatga cctgctgcgc ctccacgagc ggcgggagga ggccccccag 1381 cggcggggga actgccgcaa ctgctaacta actaagctag atgggatcgg atataccatc 1441 tcgccctgct ttgttccttc tgtctcgttt ctgtcttgaa