Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab27


LOCUS       XM_070219145            1480 bp    mRNA    linear   INV 09-DEC-2024
            (Rab27), transcript variant X2, mRNA.
ACCESSION   XM_070219145
VERSION     XM_070219145.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1480
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1480
                     /gene="Rab27"
                     /note="RAS oncogene family member Rab27; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063801"
     CDS             712..1407
                     /gene="Rab27"
                     /codon_start=1
                     /product="ras-related protein Rab-27A"
                     /protein_id="XP_070075246.1"
                     /db_xref="GeneID:108063801"
                     /translation="MTGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV
                     GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKS
                     FLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSA
                     CTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPDDLLRLHERR
                     EEAPQRRGNCRNC"
     misc_feature    733..1254
                     /gene="Rab27"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    763..786
                     /gene="Rab27"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(769..789,928..930,1096..1101,1105..1107,1186..1194)
                     /gene="Rab27"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    838..840
                     /gene="Rab27"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    850..858
                     /gene="Rab27"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    919..930
                     /gene="Rab27"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(925..930,976..981)
                     /gene="Rab27"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    1096..1107
                     /gene="Rab27"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    1186..1194
                     /gene="Rab27"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
ORIGIN      
        1 atatttaact tattaaaaca tggcaagcca tatttatcac ttaactatgt ttaaaaattg
       61 ttaaaatctt catttcaaaa taaagcagtt atcgttttca ctggcaaaat ttcttacact
      121 ttatatcaat ttcaaattga aggtccaaag ctcctttcaa agctttctcc caaaggaaaa
      181 gatgttcgct aaacgggaaa accccttcaa agtcctttca aagtccccgt gcaagttttg
      241 gctgaaagct gcgcttcagt tggcggccaa atggcaggat tacacaggtt gcaggatagt
      301 ccgtgctggg cagcgcatgg caacaggtcg ggcagcgcat cgcccgcatc cggagccaca
      361 tcctcggaat ctcaatctga atcgagattc agtcgagtcg agtttgtttt cgttttggca
      421 gcaaatcatc gaaagtcggg ggaacgaact cccgggcaga cgaattgcgc gcgctaaaaa
      481 taacggttgc ccgcctaatc cttcaatcct ccaagcctcc aatcctccag catccttcat
      541 ccttcatcct tggagtgccg aaaccccgtt tttttttggc gggcgttggg gcggaaatgc
      601 gtgccgcgcc tctgcaatta gcaattagcc ggatccggtg agcaggcgga caagatgcgt
      661 ccgctgtcct gaactcagag caaccagaga atcagagaac cagaagccag aatgacgggc
      721 gccaatatcg actacgacta cctgctcaag ttcctggtcc tcggggactc cggcgtgggc
      781 aaaacctgcc tgctctacca gtacacggac ggccggttcc acacccagtt catctccacc
      841 gtgggcatcg acttccgcga gaagcgactg ttgtacaact cccgcgggcg gcggcaccgc
      901 atccacctgc agatctggga caccgccggc caggagcgct tccggtcgct gacgacggcc
      961 ttctaccggg acgccatggg cttcctgctg atcttcgacc tgaccagcga gaagagcttc
     1021 ctggagacgg ccaactggct gtcgcagctg cggacgcacg cctactcgga ggaccccgac
     1081 gtggtgctct gcggcaacaa gtgcgacctg ctgcagctgc gcgtggtgag ccgcgaccag
     1141 gtggcggcgc tctgccggcg ctaccggctg ccctacatcg agacgagcgc ctgcaccggg
     1201 gcgaatgtga aggaggccgt cgagctgctc gtgggccgcg tcatggagcg gatcgagaac
     1261 gcggcctgca accgggagtt ctccctgctg ctcacccagt cgcgctgcct cccgaacatc
     1321 gcctacgggc agccggatga cctgctgcgc ctccacgagc ggcgggagga ggccccccag
     1381 cggcggggga actgccgcaa ctgctaacta actaagctag atgggatcgg atataccatc
     1441 tcgccctgct ttgttccttc tgtctcgttt ctgtcttgaa