Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant receptor 1a (Or1a),


LOCUS       XM_070219142            1164 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_070219142
VERSION     XM_070219142.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1164
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1164
                     /gene="Or1a"
                     /note="Odorant receptor 1a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056231"
     CDS             77..1138
                     /gene="Or1a"
                     /codon_start=1
                     /product="odorant receptor 1a isoform X2"
                     /protein_id="XP_070075243.1"
                     /db_xref="GeneID:108056231"
                     /translation="MMEMELEMKDFKSHSQWETNVDAGNRLLETQAQVDEVVGIMRVN
                     VEKVLERDQALSELSERADQLELGASQFVRQSGRLKRKHWWANIKMIIFLGIIAIILL
                     VILLVYIWPTGGGEGSKVITEGPKKYKILPYDVTQPHIYALDCCLMVFVLSFFCCSTT
                     GVDTLYGWCALGLSSQYRRLGQQLMWIQEHSDPSRSDFGFGKLFAEHARLLNLVQHFN
                     ASFMEIAFVEVLVICVLYCSVICQYIMPHTDQNFAFLGFFSMVVTTQLCIYLFGAEQV
                     RLEAEAFGRQLYEVIPWQKLSPQHRRLLLFPLQRAQRETILGAYFFELGRPLLVWIFR
                     TAGSFTTLLNALYAKYETP"
     misc_feature    152..337
                     /gene="Or1a"
                     /note="SNARE motif of VAMP2; Region: R-SNARE_VAMP2;
                     cd15870"
                     /db_xref="CDD:277223"
     misc_feature    order(152..160,164..169,173..190,194..202,206..208,
                     215..220,224..232,236..253,257..274,278..295,299..316,
                     320..328,335..337)
                     /gene="Or1a"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277223"
     misc_feature    227..229
                     /gene="Or1a"
                     /note="zero layer; other site"
                     /db_xref="CDD:277223"
     misc_feature    <467..1087
                     /gene="Or1a"
                     /note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
                     /db_xref="CDD:251636"
ORIGIN      
        1 aatagattta atttcctata tcgcctgtca ttgccacaaa ctaaaatatt tacacaaaac
       61 tgtgtgccac tggagtatga tggaaatgga gttggaaatg aaggatttca agtcgcactc
      121 ccaatgggaa accaatgtgg atgctggaaa cagacttctg gaaacgcagg cccaggtcga
      181 cgaggtggtg ggcataatga gggtgaatgt tgagaaggta ctggaacgcg atcaggcttt
      241 atccgaacta tccgaacggg ctgaccaact ggaactgggt gcctcccaat ttgttcgtca
      301 gtccggcaga ttgaagcgca aacactggtg ggccaatatc aagatgatca tatttctggg
      361 cataatcgcc ataatcctac ttgtaatttt attggtctac atttggccaa ctggcggtgg
      421 tgaaggatcg aaagttatta cggaagggcc aaagaagtat aaaatccttc cctatgacgt
      481 aactcaaccg catatctacg ccctggactg ctgcctgatg gtgttcgttc tgagcttctt
      541 ttgctgctcc accacgggag tggacacctt atatggctgg tgtgccctgg gcctgagctc
      601 ccagtaccgt cgccttggtc agcagttgat gtggattcag gagcactccg atccatctcg
      661 ttcggatttc ggtttcggca aactcttcgc cgaacatgct cgtctcttga acttggtcca
      721 acatttcaat gccagcttta tggaaattgc cttcgttgag gttctggtga tctgtgtgct
      781 ctattgttca gtgatttgcc agtacattat gccacatacc gaccagaatt tcgcctttct
      841 tgggttcttt tccatggtgg tcaccaccca attgtgcatc tatctctttg gcgccgaaca
      901 agttcgtttg gaggctgagg catttggcag acagctttac gaggtgattc cttggcaaaa
      961 actttctccg caacaccgaa gacttttact ttttcccctg caacgagctc aacgcgaaac
     1021 catcctgggt gcttattttt tcgaactggg aagaccttta ctcgtttgga tatttcgcac
     1081 agcgggctct tttacaactt tactcaacgc actttatgca aaatacgaaa cgccttagag
     1141 acactaaaac ttacgctttt atat