Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219142 1164 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070219142 VERSION XM_070219142.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1164 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1164 /gene="Or1a" /note="Odorant receptor 1a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056231" CDS 77..1138 /gene="Or1a" /codon_start=1 /product="odorant receptor 1a isoform X2" /protein_id="XP_070075243.1" /db_xref="GeneID:108056231" /translation="MMEMELEMKDFKSHSQWETNVDAGNRLLETQAQVDEVVGIMRVN VEKVLERDQALSELSERADQLELGASQFVRQSGRLKRKHWWANIKMIIFLGIIAIILL VILLVYIWPTGGGEGSKVITEGPKKYKILPYDVTQPHIYALDCCLMVFVLSFFCCSTT GVDTLYGWCALGLSSQYRRLGQQLMWIQEHSDPSRSDFGFGKLFAEHARLLNLVQHFN ASFMEIAFVEVLVICVLYCSVICQYIMPHTDQNFAFLGFFSMVVTTQLCIYLFGAEQV RLEAEAFGRQLYEVIPWQKLSPQHRRLLLFPLQRAQRETILGAYFFELGRPLLVWIFR TAGSFTTLLNALYAKYETP" misc_feature 152..337 /gene="Or1a" /note="SNARE motif of VAMP2; Region: R-SNARE_VAMP2; cd15870" /db_xref="CDD:277223" misc_feature order(152..160,164..169,173..190,194..202,206..208, 215..220,224..232,236..253,257..274,278..295,299..316, 320..328,335..337) /gene="Or1a" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277223" misc_feature 227..229 /gene="Or1a" /note="zero layer; other site" /db_xref="CDD:277223" misc_feature <467..1087 /gene="Or1a" /note="7tm Odorant receptor; Region: 7tm_6; pfam02949" /db_xref="CDD:251636" ORIGIN 1 aatagattta atttcctata tcgcctgtca ttgccacaaa ctaaaatatt tacacaaaac 61 tgtgtgccac tggagtatga tggaaatgga gttggaaatg aaggatttca agtcgcactc 121 ccaatgggaa accaatgtgg atgctggaaa cagacttctg gaaacgcagg cccaggtcga 181 cgaggtggtg ggcataatga gggtgaatgt tgagaaggta ctggaacgcg atcaggcttt 241 atccgaacta tccgaacggg ctgaccaact ggaactgggt gcctcccaat ttgttcgtca 301 gtccggcaga ttgaagcgca aacactggtg ggccaatatc aagatgatca tatttctggg 361 cataatcgcc ataatcctac ttgtaatttt attggtctac atttggccaa ctggcggtgg 421 tgaaggatcg aaagttatta cggaagggcc aaagaagtat aaaatccttc cctatgacgt 481 aactcaaccg catatctacg ccctggactg ctgcctgatg gtgttcgttc tgagcttctt 541 ttgctgctcc accacgggag tggacacctt atatggctgg tgtgccctgg gcctgagctc 601 ccagtaccgt cgccttggtc agcagttgat gtggattcag gagcactccg atccatctcg 661 ttcggatttc ggtttcggca aactcttcgc cgaacatgct cgtctcttga acttggtcca 721 acatttcaat gccagcttta tggaaattgc cttcgttgag gttctggtga tctgtgtgct 781 ctattgttca gtgatttgcc agtacattat gccacatacc gaccagaatt tcgcctttct 841 tgggttcttt tccatggtgg tcaccaccca attgtgcatc tatctctttg gcgccgaaca 901 agttcgtttg gaggctgagg catttggcag acagctttac gaggtgattc cttggcaaaa 961 actttctccg caacaccgaa gacttttact ttttcccctg caacgagctc aacgcgaaac 1021 catcctgggt gcttattttt tcgaactggg aagaccttta ctcgtttgga tatttcgcac 1081 agcgggctct tttacaactt tactcaacgc actttatgca aaatacgaaa cgccttagag 1141 acactaaaac ttacgctttt atat