Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219123             307 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913909), transcript variant X2, mRNA.
ACCESSION   XM_070219123
VERSION     XM_070219123.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..307
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..307
                     /gene="LOC138913909"
                     /note="uncharacterized LOC138913909; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913909"
     CDS             56..283
                     /gene="LOC138913909"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070075224.1"
                     /db_xref="GeneID:138913909"
                     /translation="MLIKENFNDGEEKDESKDETAVDRAQTSALINENVSDEEKYGSK
                     DETAVVRAQTPVFSFQLWILKITALLHFLMI"
ORIGIN      
        1 aaagtgacat tcaaaaaaaa ttctatagaa atgaaacgag cttgtggcga aaaaaatgct
       61 tattaaagaa aatttcaacg acggtgagga aaaagatgag tccaaggacg agaccgcagt
      121 ggatcgcgct cagacttcag ctcttattaa tgaaaatgtc agtgatgagg aaaaatatgg
      181 gtccaaggac gagaccgcag tggttcgcgc tcagactcca gtgttttcgt tccagctctg
      241 gattctaaag ataaccgctc tgctccattt cctgatgata taatggatca agttccaaat
      301 gcgtttg