Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219123 307 bp mRNA linear INV 09-DEC-2024 (LOC138913909), transcript variant X2, mRNA. ACCESSION XM_070219123 VERSION XM_070219123.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..307 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..307 /gene="LOC138913909" /note="uncharacterized LOC138913909; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913909" CDS 56..283 /gene="LOC138913909" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070075224.1" /db_xref="GeneID:138913909" /translation="MLIKENFNDGEEKDESKDETAVDRAQTSALINENVSDEEKYGSK DETAVVRAQTPVFSFQLWILKITALLHFLMI" ORIGIN 1 aaagtgacat tcaaaaaaaa ttctatagaa atgaaacgag cttgtggcga aaaaaatgct 61 tattaaagaa aatttcaacg acggtgagga aaaagatgag tccaaggacg agaccgcagt 121 ggatcgcgct cagacttcag ctcttattaa tgaaaatgtc agtgatgagg aaaaatatgg 181 gtccaaggac gagaccgcag tggttcgcgc tcagactcca gtgttttcgt tccagctctg 241 gattctaaag ataaccgctc tgctccattt cctgatgata taatggatca agttccaaat 301 gcgtttg