Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219104 1331 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_070219104 VERSION XM_070219104.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1331 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1331 /gene="LOC108054436" /note="chronophin-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054436" CDS 7..969 /gene="LOC108054436" /codon_start=1 /product="chronophin-like isoform X1" /protein_id="XP_070075205.1" /db_xref="GeneID:108054436" /translation="MPIDWEFNNELNEVKHILELSEDERRNFVDSFDRVFSDIDGVLW TLKDPVPRAAEGYAALERRGKQLTYVTNNSVLAEEQCLKRFAKIGMKVQPEQIWHPAK SIAAYLSGIKLEGLIYVIASQPFKEVMREAGFHILDGPNESIEGSFASLAEHIFDRQE VRAVVIDVDFNLSYPKLARAHQYLRHPDCLLIGGATDILLPVAKDVNILGPGAFASML ADASGRPLEAITLGKPGRQLGDLLIGHLKIEQPSRVLMIGDMLAQDIGFGRQCGFQTL LVLSGGCTRAEFLGEKDPARLPDFYADSVADVAQLLDGAPRAHV" misc_feature 106..927 /gene="LOC108054436" /note="haloacid dehalogenase-like superfamily phosphatases, UmpH/NagD family; Region: HAD_Pase_UmpH-like; cd07508" /db_xref="CDD:319811" misc_feature order(118..132,214..225,595..597,703..705,778..786, 793..798) /gene="LOC108054436" /note="active site" /db_xref="CDD:319811" ORIGIN 1 gttggaatgc caatcgattg ggaatttaat aacgagctca acgaggtcaa acacattcta 61 gagctgagcg aggatgagcg gcgcaacttt gtggactcct tcgaccgggt gttcagcgac 121 atagacggtg tcctgtggac cctgaaggat ccggtgccgc gggccgccga gggatacgct 181 gccctcgagc ggaggggcaa acagttgacc tatgtgacca acaacagcgt gctggcggag 241 gagcagtgcc tcaagcgctt cgccaagatc gggatgaagg tgcagccgga gcagatctgg 301 catccggcca agtccatcgc agcctatctg agcggcatta agctcgaggg cctcatctac 361 gtcatcgcca gccagccgtt taaggaagta atgcgcgaag cgggtttcca catactggac 421 ggacccaacg agtccatcga gggaagcttc gccagcctgg cggagcacat tttcgaccgg 481 caggaggtgc gcgccgtggt catcgacgtg gacttcaacc tgagctatcc caagttggct 541 cgagcgcatc agtatctgcg tcatccggat tgcctgctga ttggcggcgc caccgatatc 601 ctgctgcccg tggccaagga cgtgaatatc ctgggaccgg gggcgtttgc ttccatgctg 661 gcggatgcca gtggcaggcc attagaagcc attacactgg gcaaaccggg acgccagctg 721 ggcgacctgc tcatcggtca tctcaagatc gagcagccca gtcgggtgct catgatcggc 781 gacatgttgg cccaggacat tggctttggc cgccagtgcg gcttccagac gctgctcgtc 841 ctcagcggcg gctgcacgcg ggcggagttc ctcggggaga aggatcccgc ccgcctgccg 901 gacttctatg cggacagcgt ggccgatgtg gctcagctgt tggacggcgc acccagggca 961 catgtctaat taatctctaa tttataattt atcccttttc cgaggattga agtttccttg 1021 gaatatatgc atgaccatct tgcaagtccc atttgtatct ataggcattt aatatttaat 1081 attaagtcct tgccatatta tttagccttt tttttcattt ttctattgta attttcagtg 1141 aattcttaag attttttttt tgcctgaagg taaaaattat ttcattattt caaacgaatg 1201 aaattggtta gctttgaaga accataatat tgtattattc gtattgtatt gtaatgaata 1261 ctttattaat ataattttta aaaatattta atttaaatcg ttctatctag cattattgtt 1321 ttttcttttt t