PREDICTED: Drosophila takahashii Alanine-glyoxylate

LOCUS       XM_070219084            1224 bp    mRNA    linear   INV 09-DEC-2024
            aminotransferase (Agxt), transcript variant X2, mRNA.
ACCESSION   XM_070219084
VERSION     XM_070219084.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1224
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1224
                     /gene="Agxt"
                     /note="Alanine-glyoxylate aminotransferase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108054394"
     CDS             138..1169
                     /gene="Agxt"
                     /codon_start=1
                     /product="alanine--glyoxylate aminotransferase isoform X2"
                     /protein_id="XP_070075185.1"
                     /db_xref="GeneID:108054394"
                     /translation="MDEVKEGIKYIFQTLNDATMCISGAGHSGMEAALCNLIEDGDVV
                     LMGITGVWGHRAGDMARRYGAEVHYVEASFGRALTLEEITFAFEAHRPRVFFIAQGDS
                     STGIYQQNIRELGELCRQYDCFLVVDTVASLGGAEFLMDEWKVDVAYTGSQKSLGGPA
                     GITPISFSKRALTRIRKRKSKPKVYYFDILLIGQYWGCYGTPRIYHHTISSTLLYGLR
                     EALAHFCAVGLKAVVRRHQECSRRLQLGIEELGLEMFVQREEERLPTVNTIKVPFGVD
                     WKKVAEYAMRKYSVEISGGLGPTVEHVFRIGLMGENATVERVDMVLSILNEAIQSSKL
                     GIKTERSKI"
     misc_feature    138..1127
                     /gene="Agxt"
                     /note="Alanine-glyoxylate aminotransferase (AGAT) family.
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to alanine-glyoxylate
                     aminotransferase (AGAT); Region: AGAT_like; cd06451"
                     /db_xref="CDD:99744"
     misc_feature    order(210..218,291..293,441..443,519..521,525..527,
                     594..599)
                     /gene="Agxt"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99744"
     misc_feature    597..599
                     /gene="Agxt"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99744"
     polyA_site      1224
                     /gene="Agxt"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 catggatata atataatcac atgtcatatc ataaaaccat acaatataga tagaaatggt
       61 ctttaaatgt acagatagat cacattgata taatataatc acatatcata tcaaaaaacc
      121 ctacaacata aataatcatg gacgaggtga aggagggcat caagtacatc ttccagaccc
      181 taaacgacgc caccatgtgc atcagtggag cgggtcattc cggaatggag gccgccctgt
      241 gcaatctgat cgaggacggc gatgtggtgc tcatgggcat cacgggagtc tggggtcatc
      301 gtgctgggga tatggcccgt cgctatggcg ccgaagtgca ttacgtggag gcgagtttcg
      361 gccgggctct aacgctcgag gagatcacat tcgccttcga agcgcatcgt ccgcgtgtct
      421 tcttcattgc ccaaggcgac tcatcgacgg gaatttacca gcagaatatc cgtgagctgg
      481 gcgagctgtg ccgccaatac gattgcttcc tagtcgtcga tacggtggcc tcgctgggcg
      541 gtgccgaatt tctgatggac gaatggaagg tggacgtggc ctatacgggc tcacagaaat
      601 ccctcggtgg tcccgccggc attacgccca tttcgtttag taagcgcgca ttaactcgca
      661 tccggaaaag gaaatccaag ccgaaggtct actattttga tatcctgctt atcggccagt
      721 actggggatg ctatggcacg ccgagaatct atcatcacac catttcctcc actctgctct
      781 acggtttgcg cgaggcactc gctcactttt gtgccgtggg cctcaaggcg gtggtgcgac
      841 ggcatcagga gtgctcgcga cgattgcagc tgggcatcga ggagcttgga ctggaaatgt
      901 tcgtccagcg ggaggaggaa cggctgccca cggtgaacac aatcaaggtg ccgttcggcg
      961 tggactggaa aaaggtggcc gagtacgcca tgcgcaagta cagcgtggag atcagcggcg
     1021 gtctgggacc caccgtggag cacgtcttcc gcatcggttt gatgggcgaa aatgccaccg
     1081 tggagcgcgt ggacatggtt ctcagcatcc tcaacgaggc catccagagc agcaagctgg
     1141 gcatcaagac ggaacgatcc aaaatttaat gtagctcctt gtttgtattg gtttttaaat
     1201 aaaattttaa aattatcact tgaa