Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii zinc finger protein 120


LOCUS       XM_070219075            1361 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062302), transcript variant X2, mRNA.
ACCESSION   XM_070219075
VERSION     XM_070219075.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1361
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1361
                     /gene="LOC108062302"
                     /note="zinc finger protein 120; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108062302"
     CDS             187..1182
                     /gene="LOC108062302"
                     /codon_start=1
                     /product="zinc finger protein 120 isoform X2"
                     /protein_id="XP_070075176.1"
                     /db_xref="GeneID:108062302"
                     /translation="MALEQEKREESLQEEEKPGEDQEETLEEEQQPPGGHSSKRRAGL
                     ACDQCGKQVYKLPYLEAHIRSVHQGYTKPFLCRSCDKCFTRYEQLRSHMRNAHPQLEQ
                     LQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTH
                     NPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLH
                     AETAAAGGGGEPCVSLETLELHLRRHRKRREKEDSDSDSDSDSNSDSESLEDRRKRLR
                     KRQKERQQDQGCQEEQEEHLKQEEEHPEWQHKLEEDGEAQEEPFHDYKMSTSEAL"
     misc_feature    322..387
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    412..477
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    520..582
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    604..666
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(619..621,625..627,631..633,637..642,649..654,
                     661..663,706..708,712..714,724..729,736..741,748..750,
                     793..795,799..801,805..807,811..816,823..828,835..837)
                     /gene="LOC108062302"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    691..756
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    778..840
                     /gene="LOC108062302"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
        1 gccgacggag atctgcaatc tgtgccacaa tgcggtgctt tgcctggagg agctgcgcca
       61 ggtggccagg gaatccggcc agaagctcag cgagtggcaa acgccggcga tgattccctt
      121 ggacaggggc ttccgcaggt gaaggaggag ccgctggagg aggtcaacca ggaaaattcg
      181 caggaaatgg cgttagagca ggagaagcgg gaggaaagcc tgcaggagga ggaaaagcca
      241 ggagaagatc aggaggaaac cctcgaggag gagcagcagc cgccgggcgg ccacagcagc
      301 aagcgacgcg ccggtttggc ctgcgatcag tgcggcaagc aggtgtacaa gttgccctac
      361 ctggaagccc acattcgcag cgtccatcag ggctacacga agcccttcct gtgtcgcagc
      421 tgcgacaagt gcttcacccg ctacgagcag ctgcgctcgc acatgcgcaa cgcccatccg
      481 cagctggagc aactgcagca ggagctgcgc gacctcatct gcgagctgtg caatcgtcag
      541 tacagcacca agaatgcctt gggtgagcac ttgaagcgac atgcgcagcg caaggagcat
      601 gtctgcgagc attgcggcgt ggcgaaggtg acgcgcaccg agctactgac ccacctgcga
      661 acccacaatc ccacctggga gcgcttcaag tgcgagcagt gtccgcagct ctttcgccac
      721 aagagcgcca ttagtcggca tgtgcgcgtg gtgcacgagg gacagcggcg cttccagtgc
      781 ggccattgcg agaagaagtt cggcacgcat gcctcgcagg tgcggcacga gcggctgcac
      841 gcggagacgg cggcggcggg aggaggtgga gagccctgcg tttcgctgga gacgctggag
      901 ttgcacctaa ggcgccacag gaagaggagg gagaaggagg attccgattc cgattcggat
      961 tcagattcaa attcagattc agagagcctg gaggatcgga ggaagcggct gaggaagcgg
     1021 cagaaggaga gacaacaaga tcaaggctgc caggaggagc aggaggagca cctaaagcag
     1081 gaggaggagc accccgaatg gcagcacaaa ttagaggagg atggagaagc acaagaagag
     1141 cccttccatg actacaaaat gagcacttca gaggccttgt gatggctata cacctatcta
     1201 ctatatatta tatataatta aaatgaatgg gccaagaaat cttggcatca tggctgaata
     1261 ttccacgatg tgcgctactt tttagccaca aattgttaaa taattggctt tttaagcttt
     1321 ttttaacgtt gctattacaa tgtattaaat catttttata t