Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii SET and MYND domain containing,


LOCUS       XM_070219061            1583 bp    mRNA    linear   INV 09-DEC-2024
            arthropod-specific, member 8 (SmydA-8), transcript variant X1,
            mRNA.
ACCESSION   XM_070219061
VERSION     XM_070219061.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1583
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1583
                     /gene="SmydA-8"
                     /note="SET and MYND domain containing, arthropod-specific,
                     member 8; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108056417"
     CDS             9..1385
                     /gene="SmydA-8"
                     /codon_start=1
                     /product="SET domain-containing protein SmydA-8 isoform
                     X1"
                     /protein_id="XP_070075162.1"
                     /db_xref="GeneID:108056417"
                     /translation="MSALTQSPRAGDTTLAALGAHMAPCRNTTPEQLAELIDAHLGDL
                     RQEQPNWTISSSKVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCVCCHETL
                     PQTGFLCRHRCTLPVCESCSDSEEHRAECEHFRRWQPKDADAEGEQEQVNPLSLRILT
                     AVRVFHLGKEQRHLVDAMQANAERAYRREIIKAAQCFRNFPTTDRQFMDQLFRIVGVL
                     NTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPRGG
                     EITTTYTKILWGNLTRNIFLKMTKHFACDCSRCHDNTENGTYLSALFCREQGCRSLVI
                     PVQTRTLQPDWRCITCENVFPHSKMAKYQDFALNTINNRINSCSVQDMIHFINEMCPR
                     FCPSSNYVLIEAKLNVIWRMTRFDREEYTPEEMGHMDRYREEVLAILHKLGAGECTLK
                     KLITGEIQ"
     misc_feature    162..>254
                     /gene="SmydA-8"
                     /note="SET (Su(var)3-9, Enhancer-of-zeste, Trithorax)
                     domain superfamily; Region: SET; cl40432"
                     /db_xref="CDD:394802"
     misc_feature    <666..935
                     /gene="SmydA-8"
                     /note="SET domain (including SET domain and post-SET
                     domain) found in SET and MYND domain-containing protein,
                     and similar proteins; Region: SET_SMYD; cd20071"
                     /db_xref="CDD:380997"
     misc_feature    order(669..674,708..710,738..752,852..854,858..860)
                     /gene="SmydA-8"
                     /note="active site"
                     /db_xref="CDD:380997"
     misc_feature    order(669..674,708..710,738..740,849..854,858..860)
                     /gene="SmydA-8"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:380997"
     misc_feature    order(756..758,918..920,924..926,933..935)
                     /gene="SmydA-8"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:380997"
     polyA_site      1583
                     /gene="SmydA-8"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcctagccat gtccgctctc acccaatccc cccgagcggg ggacaccacc ctggccgccc
       61 tgggggccca catggcgccc tgtcgcaaca cgacgcccga gcagctggcc gagctgatag
      121 acgcccattt gggggatctg cgccaggagc agcccaactg gaccatatcc tcctcgaagg
      181 tggcgggtcg cggggtgttt gccacccggg acattgccgc cggcgagctg atcttccagg
      241 agcgggcttt ggtcacggga ccgacggcca ggaagggcca gctgagcagc tgcgtctgct
      301 gccacgagac gctgccgcag acgggcttcc tgtgccggca tcgctgcacc cttcccgttt
      361 gtgaatcctg ctcggattcg gaggagcacc gggcggagtg cgagcacttc cgccgctggc
      421 agcccaagga cgcggatgcc gagggcgagc aggagcaggt caatccgctc tcgctgcgca
      481 tcctcaccgc cgtgcgcgtc ttccatttgg gcaaggagca aaggcatctg gtggacgcca
      541 tgcaggcgaa tgcggagcgg gcctatcgac gggagatcat caaggcggcc cagtgcttca
      601 ggaacttccc caccacggat cgccagttca tggaccagct gttccgcatc gtgggcgtgc
      661 tgaacacgaa cgccttcgag gctccctgcc gctccggcgg ccacgagacg ctgctgcggg
      721 gcctcttccc gctgacggcg atcatgaacc acgagtgcac ccccaatgcg agccactact
      781 tcgagaacgg ccggctggcg gtggttcggg ccgccaggga cattcccagg ggcggcgaga
      841 tcaccaccac ctacaccaag atcctctggg gcaacctcac ccgcaacatc ttcctcaaga
      901 tgaccaagca ctttgcctgc gactgctcgc ggtgccacga caatacagag aacggaacct
      961 acctgtcggc gctcttctgc cgggaacagg gttgccgcag cctggtgatt cccgtccaga
     1021 ctcgcaccct gcagcccgac tggcggtgca tcacctgcga gaacgtgttt ccgcactcga
     1081 agatggccaa gtaccaggac ttcgccctga acaccatcaa caaccggatc aactcgtgca
     1141 gcgtccagga catgatccac ttcatcaacg agatgtgccc gcgcttctgt ccctcctcca
     1201 actacgtgct catcgaggcc aagctgaacg tcatctggcg gatgacgagg ttcgaccgcg
     1261 aggagtacac ccccgaggag atgggccaca tggatcggta tcgcgaggag gtcctggcca
     1321 tcctccacaa gctgggcgcc ggcgagtgca ccctgaagaa gctgatcacc ggggagattc
     1381 agtgaacttg tgaatactta agcgtttttt ttttttattc gcgtgtgaat gagcgagtgt
     1441 ttgttgtgaa tgaatgggtt ttgtttgggc cacggggtta aacctctggg ccctttgttg
     1501 ctattttatt cgtagtcact taaggaagaa aacaaataaa caccgaacta tgtctcttta
     1561 tgttggcccg tattttcatt gaa