Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219061 1583 bp mRNA linear INV 09-DEC-2024 arthropod-specific, member 8 (SmydA-8), transcript variant X1, mRNA. ACCESSION XM_070219061 VERSION XM_070219061.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1583 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1583 /gene="SmydA-8" /note="SET and MYND domain containing, arthropod-specific, member 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056417" CDS 9..1385 /gene="SmydA-8" /codon_start=1 /product="SET domain-containing protein SmydA-8 isoform X1" /protein_id="XP_070075162.1" /db_xref="GeneID:108056417" /translation="MSALTQSPRAGDTTLAALGAHMAPCRNTTPEQLAELIDAHLGDL RQEQPNWTISSSKVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCVCCHETL PQTGFLCRHRCTLPVCESCSDSEEHRAECEHFRRWQPKDADAEGEQEQVNPLSLRILT AVRVFHLGKEQRHLVDAMQANAERAYRREIIKAAQCFRNFPTTDRQFMDQLFRIVGVL NTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPRGG EITTTYTKILWGNLTRNIFLKMTKHFACDCSRCHDNTENGTYLSALFCREQGCRSLVI PVQTRTLQPDWRCITCENVFPHSKMAKYQDFALNTINNRINSCSVQDMIHFINEMCPR FCPSSNYVLIEAKLNVIWRMTRFDREEYTPEEMGHMDRYREEVLAILHKLGAGECTLK KLITGEIQ" misc_feature 162..>254 /gene="SmydA-8" /note="SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain superfamily; Region: SET; cl40432" /db_xref="CDD:394802" misc_feature <666..935 /gene="SmydA-8" /note="SET domain (including SET domain and post-SET domain) found in SET and MYND domain-containing protein, and similar proteins; Region: SET_SMYD; cd20071" /db_xref="CDD:380997" misc_feature order(669..674,708..710,738..752,852..854,858..860) /gene="SmydA-8" /note="active site" /db_xref="CDD:380997" misc_feature order(669..674,708..710,738..740,849..854,858..860) /gene="SmydA-8" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:380997" misc_feature order(756..758,918..920,924..926,933..935) /gene="SmydA-8" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:380997" polyA_site 1583 /gene="SmydA-8" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcctagccat gtccgctctc acccaatccc cccgagcggg ggacaccacc ctggccgccc 61 tgggggccca catggcgccc tgtcgcaaca cgacgcccga gcagctggcc gagctgatag 121 acgcccattt gggggatctg cgccaggagc agcccaactg gaccatatcc tcctcgaagg 181 tggcgggtcg cggggtgttt gccacccggg acattgccgc cggcgagctg atcttccagg 241 agcgggcttt ggtcacggga ccgacggcca ggaagggcca gctgagcagc tgcgtctgct 301 gccacgagac gctgccgcag acgggcttcc tgtgccggca tcgctgcacc cttcccgttt 361 gtgaatcctg ctcggattcg gaggagcacc gggcggagtg cgagcacttc cgccgctggc 421 agcccaagga cgcggatgcc gagggcgagc aggagcaggt caatccgctc tcgctgcgca 481 tcctcaccgc cgtgcgcgtc ttccatttgg gcaaggagca aaggcatctg gtggacgcca 541 tgcaggcgaa tgcggagcgg gcctatcgac gggagatcat caaggcggcc cagtgcttca 601 ggaacttccc caccacggat cgccagttca tggaccagct gttccgcatc gtgggcgtgc 661 tgaacacgaa cgccttcgag gctccctgcc gctccggcgg ccacgagacg ctgctgcggg 721 gcctcttccc gctgacggcg atcatgaacc acgagtgcac ccccaatgcg agccactact 781 tcgagaacgg ccggctggcg gtggttcggg ccgccaggga cattcccagg ggcggcgaga 841 tcaccaccac ctacaccaag atcctctggg gcaacctcac ccgcaacatc ttcctcaaga 901 tgaccaagca ctttgcctgc gactgctcgc ggtgccacga caatacagag aacggaacct 961 acctgtcggc gctcttctgc cgggaacagg gttgccgcag cctggtgatt cccgtccaga 1021 ctcgcaccct gcagcccgac tggcggtgca tcacctgcga gaacgtgttt ccgcactcga 1081 agatggccaa gtaccaggac ttcgccctga acaccatcaa caaccggatc aactcgtgca 1141 gcgtccagga catgatccac ttcatcaacg agatgtgccc gcgcttctgt ccctcctcca 1201 actacgtgct catcgaggcc aagctgaacg tcatctggcg gatgacgagg ttcgaccgcg 1261 aggagtacac ccccgaggag atgggccaca tggatcggta tcgcgaggag gtcctggcca 1321 tcctccacaa gctgggcgcc ggcgagtgca ccctgaagaa gctgatcacc ggggagattc 1381 agtgaacttg tgaatactta agcgtttttt ttttttattc gcgtgtgaat gagcgagtgt 1441 ttgttgtgaa tgaatgggtt ttgtttgggc cacggggtta aacctctggg ccctttgttg 1501 ctattttatt cgtagtcact taaggaagaa aacaaataaa caccgaacta tgtctcttta 1561 tgttggcccg tattttcatt gaa