Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219057 742 bp mRNA linear INV 09-DEC-2024 COQ7, mitochondrial (Coq7), transcript variant X2, mRNA. ACCESSION XM_070219057 VERSION XM_070219057.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..742 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..742 /gene="Coq7" /note="ubiquinone biosynthesis protein COQ7, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 25 Proteins" /db_xref="GeneID:108067622" CDS 24..677 /gene="Coq7" /codon_start=1 /product="5-demethoxyubiquinone hydroxylase, mitochondrial isoform X2" /protein_id="XP_070075158.1" /db_xref="GeneID:108067622" /translation="MLRGVLCAPQPRLLSLRRCLSSAAGGSAGSGVSGGSGEGTPLRP RPNALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRRQFEQLI QQHRVRPTIMTPLWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEA PHPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYAALTEVIKFGCKTAIAISKKI" misc_feature 165..665 /gene="Coq7" /note="Ubiquinone biosynthesis protein COQ7; Region: COQ7; pfam03232" /db_xref="CDD:460854" ORIGIN 1 aagttcgtga tttttttgcc ggaatgctga gaggagtcct ctgtgcgccg cagccgcgtc 61 tgctgtccct gcgtcgctgc ctcagctcag cggctggagg atctgcagga tcgggagtat 121 cgggaggctc tggagaaggc actcccctgc gcccacgtcc aaatgccctg actgacgaga 181 taatacgcgt cgatcatgcc ggcgaactgg gcgccgatcg catctacgcc ggccagatgg 241 ccattctggg caacgggccg ctgggcaaga ccatcggcca catgtgggag caggagaagg 301 agcatcgccg ccagttcgag cagctcatcc agcagcatcg cgtccgtccg acgatcatga 361 cgccgctgtg gaacgtggcc ggctttgtgc tgggcgccgg aacagcgctg atgggcgaaa 421 aggcggccat ggcctgcacg gtggccgtgg agacggtgat tgtggagcac tacaacgatc 481 agctgcgcca gatcatggag gcaccgcatc cggacaagga gctgctggcc acgatcacca 541 agttccggga cgaggagcag gagcaccacg acaccggcat cgatcacggg gccgagcagg 601 cgcccttcta cgcggccctg accgaggtga tcaagttcgg ctgcaagacg gccatagcca 661 tctcgaagaa gatctagatc tagatctaga tacataaaga tcccctgtat ataccacaca 721 ctataagcat taaagataga ga