Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ubiquinone biosynthesis protein


LOCUS       XM_070219057             742 bp    mRNA    linear   INV 09-DEC-2024
            COQ7, mitochondrial (Coq7), transcript variant X2, mRNA.
ACCESSION   XM_070219057
VERSION     XM_070219057.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..742
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..742
                     /gene="Coq7"
                     /note="ubiquinone biosynthesis protein COQ7,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 25 Proteins"
                     /db_xref="GeneID:108067622"
     CDS             24..677
                     /gene="Coq7"
                     /codon_start=1
                     /product="5-demethoxyubiquinone hydroxylase, mitochondrial
                     isoform X2"
                     /protein_id="XP_070075158.1"
                     /db_xref="GeneID:108067622"
                     /translation="MLRGVLCAPQPRLLSLRRCLSSAAGGSAGSGVSGGSGEGTPLRP
                     RPNALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRRQFEQLI
                     QQHRVRPTIMTPLWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEA
                     PHPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYAALTEVIKFGCKTAIAISKKI"
     misc_feature    165..665
                     /gene="Coq7"
                     /note="Ubiquinone biosynthesis protein COQ7; Region: COQ7;
                     pfam03232"
                     /db_xref="CDD:460854"
ORIGIN      
        1 aagttcgtga tttttttgcc ggaatgctga gaggagtcct ctgtgcgccg cagccgcgtc
       61 tgctgtccct gcgtcgctgc ctcagctcag cggctggagg atctgcagga tcgggagtat
      121 cgggaggctc tggagaaggc actcccctgc gcccacgtcc aaatgccctg actgacgaga
      181 taatacgcgt cgatcatgcc ggcgaactgg gcgccgatcg catctacgcc ggccagatgg
      241 ccattctggg caacgggccg ctgggcaaga ccatcggcca catgtgggag caggagaagg
      301 agcatcgccg ccagttcgag cagctcatcc agcagcatcg cgtccgtccg acgatcatga
      361 cgccgctgtg gaacgtggcc ggctttgtgc tgggcgccgg aacagcgctg atgggcgaaa
      421 aggcggccat ggcctgcacg gtggccgtgg agacggtgat tgtggagcac tacaacgatc
      481 agctgcgcca gatcatggag gcaccgcatc cggacaagga gctgctggcc acgatcacca
      541 agttccggga cgaggagcag gagcaccacg acaccggcat cgatcacggg gccgagcagg
      601 cgcccttcta cgcggccctg accgaggtga tcaagttcgg ctgcaagacg gccatagcca
      661 tctcgaagaa gatctagatc tagatctaga tacataaaga tcccctgtat ataccacaca
      721 ctataagcat taaagataga ga