Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219046             759 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913891), mRNA.
ACCESSION   XM_070219046
VERSION     XM_070219046.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..759
                     /gene="LOC138913891"
                     /note="uncharacterized LOC138913891; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:138913891"
     CDS             1..759
                     /gene="LOC138913891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070075147.1"
                     /db_xref="GeneID:138913891"
                     /translation="MLALELLFVSRRGIPEKVWCDNATNFVGADRHMREFRARLEEQG
                     GGIETFASRRGCEFVFIPPRAPHFGGLWEAGVKSAKHLFLRTVGEDILTAEELGTLLT
                     SVEAVLNSRPLGAISTDPNDGEALSPGHLLIGGPLLAPPSAALPDQVSPTCLRRWRSV
                     SSLRHRFWQRWSREYVSSLQAKNKWHQEVPNVAVGALVVVAEDNLPPQQWMIGRIVAV
                     HVGADGKVRVADVKTKDTTYRRAVHRLAVLPVAC"
     misc_feature    463..744
                     /gene="LOC138913891"
                     /note="Family of unknown function (DUF5641); Region:
                     DUF5641; pfam18701"
                     /db_xref="CDD:465838"
ORIGIN      
        1 atgctggccc tcgagctctt gttcgtgagt cgacgcggga ttccggagaa ggtgtggtgc
       61 gacaacgcga cgaacttcgt cggagccgat cgccacatga gagagttccg ggcccgtctg
      121 gaggagcagg ggggcggtat cgaaacattc gcatcaagaa gaggatgcga gtttgtgttc
      181 ataccgccca gagcacctca cttcggcgga ctttgggagg caggtgtgaa gtctgcaaag
      241 cacctgttcc ttcggacggt cggcgaagac atcctgaccg cggaggagct cggaactctc
      301 ctcaccagcg tggaggccgt gctcaactcc aggcccctcg gagcgatcag cacagatccc
      361 aacgacggcg aagcactaag cccaggccat ctcctgatcg gcgggcccct actagctcca
      421 ccctcagcag cgctcccgga ccaagtcagc ccaacctgct tgcgacgatg gcgcagtgtc
      481 tcgtctctca ggcacaggtt ttggcagcga tggtcccggg agtacgtctc gagcctccag
      541 gcgaaaaaca agtggcacca ggaggttcca aacgtcgccg tgggagctct cgtcgtcgtc
      601 gccgaggaca atcttccgcc gcagcagtgg atgatcggtc ggatcgtggc ggtgcacgtc
      661 ggcgctgacg gcaaggtccg agtggcggac gtgaaaacga aggatacgac gtatcggcga
      721 gcggtccata ggctggcggt gctgcctgtg gcgtgctga