Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070219044 621 bp mRNA linear INV 09-DEC-2024 (LOC138913889), mRNA. ACCESSION XM_070219044 VERSION XM_070219044.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..621 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..621 /gene="LOC138913889" /note="uncharacterized LOC138913889; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138913889" CDS 1..621 /gene="LOC138913889" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070075145.1" /db_xref="GeneID:138913889" /translation="MITNLFLIHWSHNNRKTERESKPRNCGSNFERSKSVFQIICKYI CYFRITVRGLDALVRETELPAAIAKQYGIDARKVKIRSIRPSFSGTQTAVFSLPVPQG KMVTSHRQIRIGWSLCRIRELGGPPRCFKCLELGHIAIRCKSPIDRSGNCFKCGEPGH MAAGCSKEPRCLTCATAGIKDTTHQTGSKKCPSGCSGASTTSTSCN" misc_feature <355..495 /gene="LOC138913889" /note="universal minicircle sequence binding protein (UMSBP); Provisional; Region: PTZ00368" /db_xref="CDD:173561" ORIGIN 1 atgatcacga acctcttcct catccactgg tcgcacaaca acaggaagac cgaaagagag 61 tccaaaccta gaaattgtgg ctcgaacttc gaacggagta aatcagtttt ccagatcatc 121 tgcaaataca tctgctattt cagaatcact gtcagaggtc tcgacgcgct ggtgagggag 181 acggagcttc cagctgcaat cgctaagcag tatggaatag atgcgagaaa ggtgaagatt 241 cgcagtatcc gccctagctt ttctggtaca cagacggccg tgttcagcct gccagttcct 301 caaggaaaaa tggtcacgag tcacaggcag atcaggatcg gctggtcctt atgccggatc 361 cgggagttgg gcggtccacc gcggtgcttc aagtgtctgg agctaggcca catcgcgatc 421 agatgcaaga gccctatcga caggagcggg aactgcttca agtgcggtga gccgggccac 481 atggccgcag gctgctccaa ggaaccgcgg tgcctcacct gcgccacagc gggcataaag 541 gacacgacgc accagacagg cagcaaaaaa tgcccttccg gttgcagtgg tgccagcaca 601 acatcgactt catgcaactg a