Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070219044             621 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913889), mRNA.
ACCESSION   XM_070219044
VERSION     XM_070219044.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..621
                     /gene="LOC138913889"
                     /note="uncharacterized LOC138913889; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:138913889"
     CDS             1..621
                     /gene="LOC138913889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070075145.1"
                     /db_xref="GeneID:138913889"
                     /translation="MITNLFLIHWSHNNRKTERESKPRNCGSNFERSKSVFQIICKYI
                     CYFRITVRGLDALVRETELPAAIAKQYGIDARKVKIRSIRPSFSGTQTAVFSLPVPQG
                     KMVTSHRQIRIGWSLCRIRELGGPPRCFKCLELGHIAIRCKSPIDRSGNCFKCGEPGH
                     MAAGCSKEPRCLTCATAGIKDTTHQTGSKKCPSGCSGASTTSTSCN"
     misc_feature    <355..495
                     /gene="LOC138913889"
                     /note="universal minicircle sequence binding protein
                     (UMSBP); Provisional; Region: PTZ00368"
                     /db_xref="CDD:173561"
ORIGIN      
        1 atgatcacga acctcttcct catccactgg tcgcacaaca acaggaagac cgaaagagag
       61 tccaaaccta gaaattgtgg ctcgaacttc gaacggagta aatcagtttt ccagatcatc
      121 tgcaaataca tctgctattt cagaatcact gtcagaggtc tcgacgcgct ggtgagggag
      181 acggagcttc cagctgcaat cgctaagcag tatggaatag atgcgagaaa ggtgaagatt
      241 cgcagtatcc gccctagctt ttctggtaca cagacggccg tgttcagcct gccagttcct
      301 caaggaaaaa tggtcacgag tcacaggcag atcaggatcg gctggtcctt atgccggatc
      361 cgggagttgg gcggtccacc gcggtgcttc aagtgtctgg agctaggcca catcgcgatc
      421 agatgcaaga gccctatcga caggagcggg aactgcttca agtgcggtga gccgggccac
      481 atggccgcag gctgctccaa ggaaccgcgg tgcctcacct gcgccacagc gggcataaag
      541 gacacgacgc accagacagg cagcaaaaaa tgcccttccg gttgcagtgg tgccagcaca
      601 acatcgactt catgcaactg a