Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutamate receptor interacting


LOCUS       XM_070219004            3294 bp    mRNA    linear   INV 09-DEC-2024
            protein (Grip), transcript variant X3, mRNA.
ACCESSION   XM_070219004
VERSION     XM_070219004.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3294
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3294
                     /gene="Grip"
                     /note="Glutamate receptor interacting protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:108065695"
     CDS             167..2938
                     /gene="Grip"
                     /codon_start=1
                     /product="glutamate receptor-interacting protein 1 isoform
                     X3"
                     /protein_id="XP_070075105.1"
                     /db_xref="GeneID:108065695"
                     /translation="MNMLCAGGSDAGPAIVEIEYSLPEYISQNSLCVTSKLAQITVER
                     ESGCLGLTLRGGADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQ
                     IIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLIIEIERPMNDKLGLVLCNYTPAMAA
                     SGSGSSTPSSGEKIEESTGVFIASILPASIADRCGALSVGDQVLSIDDTMIEHTAFSP
                     DEVMTILDTSTGRGYTQMQIMPAHALARRGHTALGSPKYSFSTLESRKSSTAGRQRQR
                     FARKSSLPLENAGVNTPGSSVGMVGLGLCRAESFPVLLDCSHGAGIILGESPAGGGAG
                     GGSAGGGAVAIAQILNDSVADRSGCIQAGDRIVAINKMYSLDAGAMRQLLEGGSGRGG
                     AGNNSGTPPANWLELEIEFDMPDAVVPASGVFSVKLLRAGKCGLGLSVSGSSHGGLVI
                     SDVKMGSPAHRSGSLRSGDILLAVDQHPVQHFNVDALLKEQQNPSSSASSASSDFTTL
                     TIKRIVLPDFLPMSSPIYSNCPPMAMGMGGMGVSSSSTDHDLYSSAYVTAGKYADCVS
                     LKSRTPQPDYFRVPSMDDASLQSVQLRSGSGCSGNGGSRGVNEAGNGWSTAGVNSRSF
                     GAASNQLPNTQSLTTELPEEEDEQEQLYPGYELNRYASVDCTALPPPMENKVYGSAAS
                     SSSKSSGSSLHQIIFTVRLEPKGGLLGITLAGSEDITKPITISGLVEGGIAHKNGQIH
                     VSDQLLAIDEHSVQGMPLSHATSLLQNLGDLVDLKILRSHDLANGSHLPQTQAIYAKV
                     QRRPRSPSANTEASKESGNGNSNGCGAGSNGNGGNGKPRVFHVTLYKDKVYDDYGFSV
                     SDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCLTVPLIAAAGDK
                     IEMIMQRTE"
     misc_feature    272..529
                     /gene="Grip"
                     /note="PDZ domain 2 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ2_GRIP1-2-like; cd06681"
                     /db_xref="CDD:467169"
     misc_feature    order(308..328,356..358,365..367,455..457,467..469,
                     476..481)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467169"
     misc_feature    563..886
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    order(602..622,713..715,722..724,818..820,830..832,
                     839..844)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467153"
     misc_feature    <1205..1702
                     /gene="Grip"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:273938"
     misc_feature    1436..>1591
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    2246..2500
                     /gene="Grip"
                     /note="PDZ domain 6 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ6_GRIP1-2-like; cd06683"
                     /db_xref="CDD:467171"
     misc_feature    order(2285..2305,2339..2341,2348..2350,2438..2440,
                     2450..2452,2459..2464)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467171"
     misc_feature    2672..2929
                     /gene="Grip"
                     /note="PDZ domain 7 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ7_GRIP1-2-like; cd06685"
                     /db_xref="CDD:467173"
     misc_feature    order(2717..2737,2768..2770,2777..2779,2867..2869,
                     2879..2881,2888..2893)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
     misc_feature    order(2837..2839,2846..2848,2861..2863,2870..2875,
                     2882..2887)
                     /gene="Grip"
                     /note="GRASP-1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
ORIGIN      
        1 atttggcgat ttggtgactt ggtgatttga acgcaacgat ctttcttatc cgccggtggt
       61 tggatctctg agtcccgtgg gccatgcggc ggatttcttg gcgcccggcg atcgccttca
      121 tcagatcgat ggaatctcga cgattggctt gagcaaccag aaggtgatga acatgctctg
      181 cgctggagga tcggatgcgg gtcctgccat cgtggagatc gagtactcgc tgcccgaata
      241 catttcccag aacagcctct gtgtgacctc gaagctggcg cagatcaccg tggagcggga
      301 aagtggatgc ctgggcctga cgctgagggg cggggccgac tatccgctga tcgtcaccca
      361 tgtgaggccc catggacccg tctataagac cggtcgcatc aagcccggcg atcgcttgtt
      421 gcgcgtcgat aatgtctcac ttattggcaa aacgctggca gaggcgcaac agatcatcaa
      481 gtgcggcggt catgtttccg ggtataccaa cctgaccatc gagtacgatg tttccgtggt
      541 gcagagcgtt gagttctcga tgggaccgct gatcatcgag atcgagcggc cgatgaacga
      601 taagttgggc ctggtacttt gcaactatac gccggcgatg gccgcttccg gttccggttc
      661 gagtacgcca tccagtgggg agaagatcga ggaatcgacg ggcgtcttta tagccagcat
      721 cctgcccgct agcattgcag atcgttgcgg cgccttatcc gtcggcgatc aggtgctctc
      781 catcgacgac acaatgatcg agcacaccgc cttcagtccc gacgaggtga tgaccatatt
      841 ggacaccagc acgggtcgcg gctacacgca gatgcagatc atgcccgctc acgcgttggc
      901 ccgtcgcgga cacacggcat tgggcagtcc caagtacagc tttagcaccc tggagtcccg
      961 caaatcctcg acggcgggtc gccagcgtca gcgtttcgcc cgcaagagtt ccctgccgct
     1021 ggagaatgca ggggtcaaca ctccgggatc ctcggtgggc atggtgggtc tgggcctctg
     1081 ccgcgccgag agctttcccg ttctcctcga ctgcagccac ggagcgggca ttatcctggg
     1141 ggaatctcca gcaggaggag gagcaggagg aggatctgcc ggcggaggag ctgtggccat
     1201 tgcccagatc ctcaacgatt cggtggccga tcgcagtggc tgcattcagg cgggcgatcg
     1261 cattgtggcc atcaacaaga tgtacagcct ggatgcgggg gccatgaggc agctgctcga
     1321 gggaggatcg ggtcgcggag gagcaggaaa caactcggga acgccgccgg ccaattggct
     1381 ggagctggag atcgagttcg atatgccgga tgccgtggtg cctgccagtg gtgtctttag
     1441 tgtcaagctg ctgagggccg gcaaatgtgg attgggactg agtgtgagtg gctccagcca
     1501 tggcggcctg gtcatttcgg acgtcaagat gggcagtccg gcgcatcgca gcggctcttt
     1561 gagatcgggc gacatcctgc tggccgtcga ccagcatcca gtgcagcatt tcaatgtgga
     1621 cgcactgctc aaggagcagc agaatccctc atcctccgcg tcctccgcct cctcggattt
     1681 caccacgctc accatcaagc ggatcgtcct gcccgacttc ctgcccatgt ccagtcccat
     1741 ctacagcaat tgcccaccga tggccatggg aatgggcggc atgggtgtct cgtccagcag
     1801 cacggatcac gatctgtata gcagcgccta tgtgacggcg ggcaagtacg ccgactgcgt
     1861 ctccctgaag tcgcggactc cgcagccgga ctacttccgg gtgcccagca tggacgacgc
     1921 cagtctgcag tcggtgcagc tgcgttccgg atcggggtgc tcggggaatg gcggcagtcg
     1981 aggggtcaac gaggcaggca acggctggtc caccgccggc gtcaacagcc gatcctttgg
     2041 ggcagccagc aaccaactgc ccaacaccca gagcctgacc accgagctgc ccgaggagga
     2101 ggacgaacag gagcagctgt atcccggcta cgagctcaat cgctatgcca gtgtggactg
     2161 caccgccctg ccgccgccca tggagaacaa ggtctacgga tcggcggcca gttcgagcag
     2221 caagagcagc gggagcagcc tgcaccagat catcttcacg gtgcgtctgg agcccaaggg
     2281 gggactgctg ggcatcactc tggctggcag cgaggatatc accaagccca tcacgatcag
     2341 tggtctcgtg gagggtggca ttgcgcacaa gaatggccag atccatgtga gtgaccagct
     2401 gctggccatc gacgagcact cggtgcaggg catgcccctt tcgcatgcca ccagtctgct
     2461 gcagaatctc ggcgatctgg tggacctgaa gatcctgcgg agtcacgatc tggccaacgg
     2521 cagtcatctg ccgcagacgc aggccattta cgcgaaggtc cagcggcgtc cgcggagtcc
     2581 ttcggcgaat acggaggcca gcaaggagtc ggggaatgga aatagcaacg gatgtggagc
     2641 tggcagtaat ggcaatggcg gaaatggaaa gccccgcgtc ttccatgtca ccctgtacaa
     2701 ggacaaggtg tacgacgact atggcttctc ggtttccgat ggactctacg agcggggcgt
     2761 cttcatcaac aggattcgca gtggcgggcc ggcggatatg tgcggtctcc tgaagccctt
     2821 cgatcgcatt atgcaggtta acgaaatgaa gacgcaggac tttgattgct gccttactgt
     2881 tccgctgatc gccgccgccg gcgataaaat cgagatgatc atgcagcgca cagagtgatc
     2941 ctcagtgtgc gcgatcctta tgttaaacta gttgtacgct aagctaatcc taagtgccat
     3001 tgctagccca taatattata tacgatatcc cctccgtatt ctgtattctg tatgctgtac
     3061 tccttaccga acgaaacgta atccacgaaa cagaaagata aacaccaacc ttcaaggaca
     3121 ataagctctc taaacaacag tctgccataa ccaaaaaatg tcctctattt aatataaatc
     3181 tgccataatt ttacattaat tctacgctaa atttgtttcc tagcaaataa ataatcatac
     3241 cgacagtttg tttcaaacta aacaatcaag aactatgagt aatttcattg ctgt