Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218985 725 bp mRNA linear INV 09-DEC-2024 (LOC138913877), mRNA. ACCESSION XM_070218985 VERSION XM_070218985.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..725 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..725 /gene="LOC138913877" /note="uncharacterized LOC138913877; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913877" CDS 47..673 /gene="LOC138913877" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070075086.1" /db_xref="GeneID:138913877" /translation="MNNQPKKEICKNLGSSSDRVAVSHVIYVKKNGQRYRKFFFPKCC ARHLVQLVIRMFNGPIDPFFQPIFLYFADFLQRYLESEQNDDWSDEELTYIHEGESSD EVEMKKKEPEKDTIKKSEEKTGKINEKAKKVKETIFLSERKVPEETAEKVAISNADED LYEDDMLYYLYESQAQIAEDNLQKKKPGNKEAYFMQFDISFYCHAKKN" ORIGIN 1 ctctttatcc acctctagta aaactttcaa tctatgtact aaaaaaatga ataatcaacc 61 gaagaaggaa atttgcaaaa acttgggcag ttcttcggac agagtggcgg tgtcgcacgt 121 catttatgtc aagaagaacg ggcagagata tcgcaaattc ttctttccca agtgctgcgc 181 ccgacacttg gtgcagctgg tcatcaggat gttcaacgga cccatcgatc ccttttttca 241 gcccattttc ctctacttcg ccgatttcct tcagcggtat ttggaatcgg agcagaatga 301 cgactggagc gacgaggaac tcacatatat ccatgaaggt gagtcttctg acgaggttga 361 gatgaaaaag aaagagcccg agaaagatac aatcaaaaag tctgaagaaa aaactggaaa 421 aataaatgag aaagccaaaa aggttaagga aacgatattc ctgtctgaaa ggaaagttcc 481 cgaggaaact gcggaaaaag tggcgatttc aaatgcagac gaggaccttt atgaagacga 541 tatgttgtat tatttatatg agagccaagc acaaatagcc gaggataacc tacagaaaaa 601 gaaaccaggg aataaggagg cctattttat gcaattcgat attagtttct attgtcatgc 661 gaagaagaat taaaagaata acaaaatgta gattgaagac gaggagattc caaaccataa 721 atgaa