Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218970 937 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_070218970 VERSION XM_070218970.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..937 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..937 /gene="LOC138913868" /note="chymotrypsin-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138913868" CDS 27..848 /gene="LOC138913868" /codon_start=1 /product="chymotrypsin-1" /protein_id="XP_070075071.1" /db_xref="GeneID:138913868" /translation="MADPRIHHLSVLGLLILGLIFAISGAEASPPQGRILGGEDVEQG EYPWSASIRYNKAHVCSGCIISQTRILTAAHCVSDVGVTPVSISDLAVRVGTINQYAG GIIVNVRSVVIHPSYGNFLHDLAILEVDPLTFSDRIAAIDLPSTEVEGSGETETETED VDAELPNGTPVYVAGWGEQSDGTVAYKQQKSNFNTLSRSLCEWQAGYGYESVVCLSRA ENEGICRGDAGAAVIDDQKVLRGVTSFNFGPCGSKYPDVATRISYYLTWIEANSQ" misc_feature 126..830 /gene="LOC138913868" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 129..131 /gene="LOC138913868" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(249..251,393..395,708..710) /gene="LOC138913868" /note="active site" /db_xref="CDD:238113" misc_feature order(690..692,756..758,762..764) /gene="LOC138913868" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 937 /gene="LOC138913868" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcccgttcag ttgccaatcc atcgccatgg ctgatccacg cattcaccac ctgtccgtcc 61 tcggcctgct aattctcggc ctgatcttcg ccatttcggg ggcggaggcc tcgccacccc 121 aaggccgcat cctgggcggc gaggatgtcg agcagggcga gtacccctgg tccgcctcca 181 ttcgctacaa caaggcccac gtctgctccg gctgcatcat ctcgcagacc cgcatcctga 241 ccgccgccca ctgcgtctcc gatgtgggcg tcactccagt gtccatcagc gacttggccg 301 tgcgagtggg caccattaac cagtatgccg gcggcatcat cgtgaacgtg agatcggtcg 361 tcattcatcc ctcctacggc aacttcctgc acgacctggc cattctggag gtcgatcccc 421 tgaccttcag cgatcgcatc gcagccatcg acctgcccag caccgaagtg gagggcagtg 481 gcgaaacgga aacggaaacg gaggatgtgg acgcggagct gcccaacgga acgcccgtct 541 atgtggccgg ttggggtgaa cagtcggatg ggacggtggc ctacaagcag cagaagtcca 601 acttcaatac gctgagccga tcgctctgcg aatggcaggc gggctatggc tacgagtcgg 661 tggtctgcct ctcgagggcc gagaacgagg gcatttgccg cggtgatgcc ggtgcggcgg 721 tcatcgatga ccagaaggtg ctgcgcggcg tgaccagctt caatttcgga ccctgcggca 781 gcaagtatcc cgatgtggcc acccgcatct cctactacct cacctggatc gaggccaaca 841 gccagtaaac gaggattagc ccttttcctt tttttttcta cattttttta ctgtgcataa 901 aatgtgtgtt tcaccctcaa agaaaaaaaa aaagaaa