Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218969 726 bp mRNA linear INV 09-DEC-2024 (LOC138913867), transcript variant X2, mRNA. ACCESSION XM_070218969 VERSION XM_070218969.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..726 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..726 /gene="LOC138913867" /note="uncharacterized LOC138913867; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913867" CDS 107..625 /gene="LOC138913867" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070075070.1" /db_xref="GeneID:138913867" /translation="MFYAMKKINGCQCKHCVPIKGPNFPGLRANSGKGILDRMRLAKE QELRASRPDKYPPLPKIKKQENIRQVKLSAGHRPPKRSPFCSTELEKWTRAEISNAFD RLKAKRFRKLLKDGRDFQPTKRNLKKRPISSRELKKWTRNEVENALDRFDRAGTFNRL RDISRFRIKREF" ORIGIN 1 gctgttgaac attttctcat aaacgtcaaa tgtcaagcaa gtgtcaaaaa atatacctgt 61 cccactttca caatttttct gtgctgaaga ctacatctcg aggaaaatgt tttacgctat 121 gaaaaaaatc aatggatgcc agtgcaagca ctgtgtccct atcaaggggc ctaatttccc 181 tggcctgcgt gcgaattctg gtaagggaat tttggaccga atgagactgg ccaaggaaca 241 agagttgcgg gccagcaggc cagataaata tccgccgctg cccaagatta agaagcagga 301 gaatattcga caggtgaaac taagtgcagg ccacagacca ccaaagagat ctccattttg 361 ttccactgaa ttggagaaat ggacgagggc tgaaatatca aatgccttcg atcgcttgaa 421 ggccaagagg tttcgcaaat tgttgaaaga cggcagggac tttcagccga ctaaacgtaa 481 tctcaagaaa aggccaattt cttcaagaga acttaagaaa tggacacgca acgaagtaga 541 aaatgccctc gatcgcttcg atcgagcagg gacattcaac cgactacgag atatctcgcg 601 attcagaatt aaacgggaat tttaaaaatc tgtacatgcc gaaggtcttg tggtacacag 661 attactgtaa aatgatccct gtttgtggaa taaagtggac tttcagtcca gaaataacaa 721 taaacg