Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218969             726 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913867), transcript variant X2, mRNA.
ACCESSION   XM_070218969
VERSION     XM_070218969.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..726
                     /gene="LOC138913867"
                     /note="uncharacterized LOC138913867; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913867"
     CDS             107..625
                     /gene="LOC138913867"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070075070.1"
                     /db_xref="GeneID:138913867"
                     /translation="MFYAMKKINGCQCKHCVPIKGPNFPGLRANSGKGILDRMRLAKE
                     QELRASRPDKYPPLPKIKKQENIRQVKLSAGHRPPKRSPFCSTELEKWTRAEISNAFD
                     RLKAKRFRKLLKDGRDFQPTKRNLKKRPISSRELKKWTRNEVENALDRFDRAGTFNRL
                     RDISRFRIKREF"
ORIGIN      
        1 gctgttgaac attttctcat aaacgtcaaa tgtcaagcaa gtgtcaaaaa atatacctgt
       61 cccactttca caatttttct gtgctgaaga ctacatctcg aggaaaatgt tttacgctat
      121 gaaaaaaatc aatggatgcc agtgcaagca ctgtgtccct atcaaggggc ctaatttccc
      181 tggcctgcgt gcgaattctg gtaagggaat tttggaccga atgagactgg ccaaggaaca
      241 agagttgcgg gccagcaggc cagataaata tccgccgctg cccaagatta agaagcagga
      301 gaatattcga caggtgaaac taagtgcagg ccacagacca ccaaagagat ctccattttg
      361 ttccactgaa ttggagaaat ggacgagggc tgaaatatca aatgccttcg atcgcttgaa
      421 ggccaagagg tttcgcaaat tgttgaaaga cggcagggac tttcagccga ctaaacgtaa
      481 tctcaagaaa aggccaattt cttcaagaga acttaagaaa tggacacgca acgaagtaga
      541 aaatgccctc gatcgcttcg atcgagcagg gacattcaac cgactacgag atatctcgcg
      601 attcagaatt aaacgggaat tttaaaaatc tgtacatgcc gaaggtcttg tggtacacag
      661 attactgtaa aatgatccct gtttgtggaa taaagtggac tttcagtcca gaaataacaa
      721 taaacg