Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218968             780 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913867), transcript variant X1, mRNA.
ACCESSION   XM_070218968
VERSION     XM_070218968.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..780
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..780
                     /gene="LOC138913867"
                     /note="uncharacterized LOC138913867; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913867"
     CDS             107..688
                     /gene="LOC138913867"
                     /codon_start=1
                     /product="uncharacterized protein isoform X1"
                     /protein_id="XP_070075069.1"
                     /db_xref="GeneID:138913867"
                     /translation="MFYAMKKINGCQCKHCVPIKGPNFPGLRANSGKGILDRMRLAKE
                     QELRASRPDKYPPLPKIKKQENIRQVCVECSNLLVEIMRKQFRYKLRKLSAGHRPPKR
                     SPFCSTELEKWTRAEISNAFDRLKAKRFRKLLKDGRDFQPTKRNLKKRPISSRELKKW
                     TRNEVENALDRFDRAGTFNRLRDISRFRIKREF"
ORIGIN      
        1 gctgttgaac attttctcat aaacgtcaaa tgtcaagcaa gtgtcaaaaa atatacctgt
       61 cccactttca caatttttct gtgctgaaga ctacatctcg aggaaaatgt tttacgctat
      121 gaaaaaaatc aatggatgcc agtgcaagca ctgtgtccct atcaaggggc ctaatttccc
      181 tggcctgcgt gcgaattctg gtaagggaat tttggaccga atgagactgg ccaaggaaca
      241 agagttgcgg gccagcaggc cagataaata tccgccgctg cccaagatta agaagcagga
      301 gaatattcga caggtgtgcg tagaatgtag taatttgctt gtggaaatta tgagaaaaca
      361 atttcggtac aaacttagga aactaagtgc aggccacaga ccaccaaaga gatctccatt
      421 ttgttccact gaattggaga aatggacgag ggctgaaata tcaaatgcct tcgatcgctt
      481 gaaggccaag aggtttcgca aattgttgaa agacggcagg gactttcagc cgactaaacg
      541 taatctcaag aaaaggccaa tttcttcaag agaacttaag aaatggacac gcaacgaagt
      601 agaaaatgcc ctcgatcgct tcgatcgagc agggacattc aaccgactac gagatatctc
      661 gcgattcaga attaaacggg aattttaaaa atctgtacat gccgaaggtc ttgtggtaca
      721 cagattactg taaaatgatc cctgtttgtg gaataaagtg gactttcagt ccagaaataa