Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218968 780 bp mRNA linear INV 09-DEC-2024 (LOC138913867), transcript variant X1, mRNA. ACCESSION XM_070218968 VERSION XM_070218968.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..780 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..780 /gene="LOC138913867" /note="uncharacterized LOC138913867; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913867" CDS 107..688 /gene="LOC138913867" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_070075069.1" /db_xref="GeneID:138913867" /translation="MFYAMKKINGCQCKHCVPIKGPNFPGLRANSGKGILDRMRLAKE QELRASRPDKYPPLPKIKKQENIRQVCVECSNLLVEIMRKQFRYKLRKLSAGHRPPKR SPFCSTELEKWTRAEISNAFDRLKAKRFRKLLKDGRDFQPTKRNLKKRPISSRELKKW TRNEVENALDRFDRAGTFNRLRDISRFRIKREF" ORIGIN 1 gctgttgaac attttctcat aaacgtcaaa tgtcaagcaa gtgtcaaaaa atatacctgt 61 cccactttca caatttttct gtgctgaaga ctacatctcg aggaaaatgt tttacgctat 121 gaaaaaaatc aatggatgcc agtgcaagca ctgtgtccct atcaaggggc ctaatttccc 181 tggcctgcgt gcgaattctg gtaagggaat tttggaccga atgagactgg ccaaggaaca 241 agagttgcgg gccagcaggc cagataaata tccgccgctg cccaagatta agaagcagga 301 gaatattcga caggtgtgcg tagaatgtag taatttgctt gtggaaatta tgagaaaaca 361 atttcggtac aaacttagga aactaagtgc aggccacaga ccaccaaaga gatctccatt 421 ttgttccact gaattggaga aatggacgag ggctgaaata tcaaatgcct tcgatcgctt 481 gaaggccaag aggtttcgca aattgttgaa agacggcagg gactttcagc cgactaaacg 541 taatctcaag aaaaggccaa tttcttcaag agaacttaag aaatggacac gcaacgaagt 601 agaaaatgcc ctcgatcgct tcgatcgagc agggacattc aaccgactac gagatatctc 661 gcgattcaga attaaacggg aattttaaaa atctgtacat gccgaaggtc ttgtggtaca 721 cagattactg taaaatgatc cctgtttgtg gaataaagtg gactttcagt ccagaaataa