Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218962             413 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065462), transcript variant X2, mRNA.
ACCESSION   XM_070218962
VERSION     XM_070218962.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..413
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..413
                     /gene="LOC108065462"
                     /note="uncharacterized LOC108065462; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065462"
     CDS             101..325
                     /gene="LOC108065462"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070075063.1"
                     /db_xref="GeneID:108065462"
                     /translation="MLGDLESIRKILPAEKAATGGWEMSDFPENSMEMARKNHRGTGR
                     LCMIFRLGKHPRCEFINGFPPADSNTPIKD"
ORIGIN      
        1 ccaaatccca atcgcacaac atcactgcga ctttattgtc taaatatgtc ggagaaggca
       61 aattttgaaa cccctattcg tattgaattg cagttcgaaa atgttaggcg atctggagag
      121 cattaggaaa atcctgccag cggaaaaggc ggccacaggt ggatgggaaa tgagtgattt
      181 tccggaaaat tccatggaaa tggccagaaa aaatcatcga ggaacgggaa gactgtgcat
      241 gatctttcga ctgggaaagc atccacgttg cgagttcatc aatggatttc ctccagccga
      301 ttcaaataca cccataaaag actaaaatgg aaccttaatc actgagaaat attcttacta
      361 aatacaagta atacaaaatc aaatccattt ttaaaagatt ttatttgtaa aaa