Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218961 380 bp mRNA linear INV 09-DEC-2024 (LOC108065462), transcript variant X1, mRNA. ACCESSION XM_070218961 VERSION XM_070218961.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..380 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..380 /gene="LOC108065462" /note="uncharacterized LOC108065462; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065462" CDS 101..346 /gene="LOC108065462" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_070075062.1" /db_xref="GeneID:108065462" /translation="MLGDLESIRKILPAEKAATGGWEMSDFPENSMEMARKNHRGTGR LCMIFRLGKHPRCEFINGFPPADSNTPMYGTNNYNIK" ORIGIN 1 ccaaatccca atcgcacaac atcactgcga ctttattgtc taaatatgtc ggagaaggca 61 aattttgaaa cccctattcg tattgaattg cagttcgaaa atgttaggcg atctggagag 121 cattaggaaa atcctgccag cggaaaaggc ggccacaggt ggatgggaaa tgagtgattt 181 tccggaaaat tccatggaaa tggccagaaa aaatcatcga ggaacgggaa gactgtgcat 241 gatctttcga ctgggaaagc atccacgttg cgagttcatc aatggatttc ctccagccga 301 ttcaaataca cccatgtatg gcacaaataa ttataatatt aaataataat aattaaataa 361 ttatttctat aactctaaaa