PREDICTED: Drosophila takahashii NADH-cytochrome b5 reductase-like

LOCUS       XM_070218955            1116 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058194), transcript variant X3, mRNA.
ACCESSION   XM_070218955
VERSION     XM_070218955.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1116
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1116
                     /gene="LOC108058194"
                     /note="NADH-cytochrome b5 reductase-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108058194"
     CDS             87..1028
                     /gene="LOC108058194"
                     /codon_start=1
                     /product="NADH-cytochrome b5 reductase-like"
                     /protein_id="XP_070075056.1"
                     /db_xref="GeneID:108058194"
                     /translation="MLPNEDVQEDLLQDSDCCGNGCTNCILDHRPRPSKRVLLAGKRN
                     VILGYTKFRLLRRESKSDGQVLLLHFGHAASEEKEEEETETDAVLDIPPGHHVMLRVG
                     SLLRPYSPYWSDFLAREFRILVKLQPDGAMSRHLSAVRPNDLLEFRGPIGQYAHDPLE
                     AKCLFILAQGVAIAPTMPLVRQVLENEEDMSRVWHLVCARDLQHVHFREELLEFAQFW
                     NYRSCLYLPHQQCEAEACQDQDQDQVGCLHFRRSLRYKEAARVARLDASELASHLNPS
                     IPGQRVLIVAGDASFQRTMAQLASHSLAVDPASVYLL"
     misc_feature    342..>734
                     /gene="LOC108058194"
                     /note="Cytochrome b5 reductase catalyzes the reduction of
                     2 molecules of cytochrome b5 using NADH as an electron
                     donor. Like ferredoxin reductases, these proteins have an
                     N-terminal FAD binding subdomain and a C-terminal NADH
                     binding subdomain, separated by a...; Region:
                     cyt_b5_reduct_like; cd06183"
                     /db_xref="CDD:99780"
     misc_feature    order(372..374,402..413,453..461,465..467,471..485,
                     597..599,606..611)
                     /gene="LOC108058194"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(402..404,408..413)
                     /gene="LOC108058194"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(474..476,483..485,492..494,510..512,534..536,
                     540..542)
                     /gene="LOC108058194"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(582..584,594..605,609..611)
                     /gene="LOC108058194"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99780"
ORIGIN      
        1 tttagtgttg gccaactttt ttgagagctt tttaaaattg ttgatgtttt tgatagttaa
       61 tttagatttt attaactaaa atacacatgc ttccaaacga ggatgtgcag gaggatctgc
      121 tgcaggattc ggactgctgc ggcaatggtt gcaccaactg catcctggac caccggccac
      181 ggcccagcaa gcgcgtcctg ctggccggca aacgcaacgt gatcctgggc tacacgaagt
      241 tccgcctgtt gcgccgggaa tccaaatccg atggccaggt gctcctcctg cactttggcc
      301 acgccgcctc cgaggagaag gaggaggagg agacggagac ggacgccgtg ctagacatcc
      361 cacccggcca tcatgtgatg ctgcgcgtcg gctccctgct gcgtccctat tcgccctact
      421 ggagcgactt cctggccagg gagttccgca tcctggtgaa gctgcagccg gatggcgcca
      481 tgtcccgtca cctctccgcc gtgcggccca acgatctgct cgagttccgc ggacccatcg
      541 gccagtacgc gcatgatccg ctggaggcca agtgcctgtt tattctcgcc cagggcgtgg
      601 ccattgcgcc caccatgccg ctggttcgcc aggtgctgga gaacgaggag gacatgagcc
      661 gggtgtggca cctggtctgc gcccgcgacc tgcagcacgt ccacttccgc gaggagctgc
      721 tcgagtttgc ccagttctgg aactaccgca gctgcctcta cctgccgcat cagcagtgcg
      781 aggcggaggc ttgccaggat caggatcagg atcaggttgg gtgcctccac ttccgccgca
      841 gcctgcgcta caaggaggcg gcccgggtgg cccgcctgga tgcctccgag cttgccagcc
      901 acctgaatcc ctccattccc ggccagcgcg tcctcatcgt cgccggagac gccagcttcc
      961 agaggaccat ggcccaattg gccagccatt ccctggccgt ggatccggcc agcgtttatt
     1021 tgctgtaaat gtcttgagtc cctgataggg cagcgatgtg gacggcggta tgtggaccgc
     1081 atgctgcgag gactggtgag gctgcggagt gagcgg