Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218953 1168 bp mRNA linear INV 09-DEC-2024 (LOC108058194), transcript variant X1, mRNA. ACCESSION XM_070218953 VERSION XM_070218953.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1168 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1168 /gene="LOC108058194" /note="NADH-cytochrome b5 reductase-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108058194" CDS 87..1028 /gene="LOC108058194" /codon_start=1 /product="NADH-cytochrome b5 reductase-like" /protein_id="XP_070075054.1" /db_xref="GeneID:108058194" /translation="MLPNEDVQEDLLQDSDCCGNGCTNCILDHRPRPSKRVLLAGKRN VILGYTKFRLLRRESKSDGQVLLLHFGHAASEEKEEEETETDAVLDIPPGHHVMLRVG SLLRPYSPYWSDFLAREFRILVKLQPDGAMSRHLSAVRPNDLLEFRGPIGQYAHDPLE AKCLFILAQGVAIAPTMPLVRQVLENEEDMSRVWHLVCARDLQHVHFREELLEFAQFW NYRSCLYLPHQQCEAEACQDQDQDQVGCLHFRRSLRYKEAARVARLDASELASHLNPS IPGQRVLIVAGDASFQRTMAQLASHSLAVDPASVYLL" misc_feature 342..>734 /gene="LOC108058194" /note="Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a...; Region: cyt_b5_reduct_like; cd06183" /db_xref="CDD:99780" misc_feature order(372..374,402..413,453..461,465..467,471..485, 597..599,606..611) /gene="LOC108058194" /note="FAD binding pocket [chemical binding]; other site" /db_xref="CDD:99780" misc_feature order(402..404,408..413) /gene="LOC108058194" /note="FAD binding motif [chemical binding]; other site" /db_xref="CDD:99780" misc_feature order(474..476,483..485,492..494,510..512,534..536, 540..542) /gene="LOC108058194" /note="phosphate binding motif [ion binding]; other site" /db_xref="CDD:99780" misc_feature order(582..584,594..605,609..611) /gene="LOC108058194" /note="beta-alpha-beta structure motif; other site" /db_xref="CDD:99780" ORIGIN 1 tttagtgttg gccaactttt ttgagagctt tttaaaattg ttgatgtttt tgatagttaa 61 tttagatttt attaactaaa atacacatgc ttccaaacga ggatgtgcag gaggatctgc 121 tgcaggattc ggactgctgc ggcaatggtt gcaccaactg catcctggac caccggccac 181 ggcccagcaa gcgcgtcctg ctggccggca aacgcaacgt gatcctgggc tacacgaagt 241 tccgcctgtt gcgccgggaa tccaaatccg atggccaggt gctcctcctg cactttggcc 301 acgccgcctc cgaggagaag gaggaggagg agacggagac ggacgccgtg ctagacatcc 361 cacccggcca tcatgtgatg ctgcgcgtcg gctccctgct gcgtccctat tcgccctact 421 ggagcgactt cctggccagg gagttccgca tcctggtgaa gctgcagccg gatggcgcca 481 tgtcccgtca cctctccgcc gtgcggccca acgatctgct cgagttccgc ggacccatcg 541 gccagtacgc gcatgatccg ctggaggcca agtgcctgtt tattctcgcc cagggcgtgg 601 ccattgcgcc caccatgccg ctggttcgcc aggtgctgga gaacgaggag gacatgagcc 661 gggtgtggca cctggtctgc gcccgcgacc tgcagcacgt ccacttccgc gaggagctgc 721 tcgagtttgc ccagttctgg aactaccgca gctgcctcta cctgccgcat cagcagtgcg 781 aggcggaggc ttgccaggat caggatcagg atcaggttgg gtgcctccac ttccgccgca 841 gcctgcgcta caaggaggcg gcccgggtgg cccgcctgga tgcctccgag cttgccagcc 901 acctgaatcc ctccattccc ggccagcgcg tcctcatcgt cgccggagac gccagcttcc 961 agaggaccat ggcccaattg gccagccatt ccctggccgt ggatccggcc agcgtttatt 1021 tgctgtaaat atttataaag gacaaaaaaa aacacgaaat catggcttcc ttgggaggct 1081 gaagcatgga atatcagcag atattttaca tttagaagga ttattcaaga accaaaagga 1141 aattcctatg gttacacatt ttccgggc