Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Protein phosphatase 1 at 13C


LOCUS       XM_070218936            1782 bp    mRNA    linear   INV 09-DEC-2024
            (Pp1-13C), transcript variant X2, mRNA.
ACCESSION   XM_070218936
VERSION     XM_070218936.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1782
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1782
                     /gene="Pp1-13C"
                     /note="Protein phosphatase 1 at 13C; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 20
                     Proteins"
                     /db_xref="GeneID:108054085"
     CDS             646..1554
                     /gene="Pp1-13C"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase alpha-3
                     isoform"
                     /protein_id="XP_070075037.1"
                     /db_xref="GeneID:108054085"
                     /translation="MAEVLNLDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIL
                     LAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETI
                     CLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVV
                     AIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGEND
                     RGVSFTFGAEVVGKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN
                     AGAMMSVDDTLMCSFQILKPVEKRKK"
     misc_feature    661..1533
                     /gene="Pp1-13C"
                     /note="PP1, PPKL (PP1 and kelch-like) enzymes, and related
                     proteins, metallophosphatase domain; Region: MPP_PP1_PPKL;
                     cd07414"
                     /db_xref="CDD:277359"
     misc_feature    order(829..831,835..837,913..915,925..927,1009..1014,
                     1024..1029,1039..1041,1156..1158,1222..1230,1255..1257,
                     1297..1305,1381..1383,1453..1467)
                     /gene="Pp1-13C"
                     /note="active site"
                     /db_xref="CDD:277359"
     misc_feature    order(829..831,835..837,913..915,1009..1011,1156..1158,
                     1381..1383)
                     /gene="Pp1-13C"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:277359"
     misc_feature    order(925..927,1024..1029,1039..1041,1222..1230,
                     1255..1257,1297..1305,1453..1467)
                     /gene="Pp1-13C"
                     /note="natural toxin binding site [chemical binding];
                     other site"
                     /db_xref="CDD:277359"
     misc_feature    order(1174..1176,1180..1182,1231..1233,1246..1248,
                     1285..1287,1312..1314,1336..1341,1345..1353,1357..1365,
                     1408..1410,1420..1422,1501..1506,1510..1512,1516..1518,
                     1522..1524)
                     /gene="Pp1-13C"
                     /note="MYPT1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277359"
ORIGIN      
        1 ttcatttagt tacaaaaaaa aaagcggtca ccatttccga gtcaaaattt gtttcaaaat
       61 tccaaagcca ccgcaaaaag tgacgagttc cggccagtca aaagtgcatt gtataccttt
      121 tcccgatccc atatcagtct atatatccag taataaatca gtaatcttgt tcgtaaacca
      181 tcaaaaaatc gcacataacc tcaaactgcg aacgtgcgag tgagaggcaa ggaaaaaagg
      241 tggagtgaag agtgcaagtg accgatacat gacctatgac acagggcacc gatcaagtga
      301 aagggttctg tagatctttt tgatagaagc caaaaagcaa agcgagaaca tattcataaa
      361 ataaaacaag gcgacaacaa cgcagctagt aaattgaaaa aaaaaatcag aaaaataaaa
      421 ataaaaatca acgcggagaa aacgaagaag tgaaagcacg ctgtacaaaa tagtaaatca
      481 agtgtataag aatatcgatt caataccggt ttgaggcctc cagttcccgt caatttatcc
      541 ggactatcag ggtgagtccc tgatccccaa tcagcaccaa cggcgtccca ggcggttggc
      601 agatccggcc cggacaacgt agccgcggct cgcaagaccg acggaatggc ggaggttctc
      661 aatctggaca gcatcatttc ccgcctcctg gaggtgcgtg gcgcccgacc gggcaagaat
      721 gtccagttgt ccgagggtga gatacgcggg ttgtgcctta aatcccgtga gatcctgctg
      781 gcccaaccta tattacttga acttgaggcc ccgctcaaga tttgcggcga catccatggc
      841 cagtactatg atctattgcg cctcttcgag tacggcggct atccgcccga atccaactat
      901 ctgttcctgg gcgactatgt cgataggggc aaacagtcgc tggaaaccat ctgcctgctg
      961 ttggcctaca agatcaagta ctcggagaat ttcttcctgc tccgcggcaa tcacgaatgc
     1021 gccagcatca ataggatcta tggattctac gatgagtgca agcgccggta tacgatcaag
     1081 ttgtggaaga ccttcaccga ttgcttcaac tgcctgcccg tggtggcgat tgtcgatgag
     1141 aagatcttct gctgccacgg gggcttgtca ccggatctga cctccatgga gcagatacgc
     1201 cgcataatgc gacccaccga tgtgccggat cagggactcc tgtgcgacct cctttggtcc
     1261 gatcccgaca aggacaccat tggctggggt gaaaacgatc gcggcgtgag cttcaccttt
     1321 ggcgccgagg tggtgggcaa gtttctgcag aaacatgacc ttgacttgat ttgtcgcgcc
     1381 catcaggtgg tggaggatgg ctatgagttc ttcgccaaac gccaactggt cacacttttc
     1441 tcggcgccca actattgcgg cgaattcgat aatgccgggg ccatgatgtc cgtggacgat
     1501 acgctaatgt gctccttcca gatcctaaag cccgtggaga agcgcaaaaa gtagaagatc
     1561 tcaagaaaaa tcgaacccca agaacatata tcacgaaaca tagacaacac aaaacaaatc
     1621 cccgtcccac actctcactc gaaaacaaag aaaacgaatg cctatcatga ttactatgtc
     1681 gtcaactgga tctaagaaca cgccccgacc tcaacatgga tcgcaaatgg aatgtactga
     1741 tgattttaat ccgcactttg gttgtgtata aagaattcta ac