Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii E3 ubiquitin-protein ligase Kcmf1


LOCUS       XM_070218920            1183 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065473), transcript variant X1, mRNA.
ACCESSION   XM_070218920
VERSION     XM_070218920.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1183
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1183
                     /gene="LOC108065473"
                     /note="E3 ubiquitin-protein ligase Kcmf1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108065473"
     CDS             338..1006
                     /gene="LOC108065473"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase Kcmf1 isoform X1"
                     /protein_id="XP_070075021.1"
                     /db_xref="GeneID:108065473"
                     /translation="MESPTGILDRQDSAMSLHWDINCDGCGTPRLLLYRFKCLRCPDY
                     DLCAECHEDGITGGDHERGHPFQCLLDRAARELHFGGGTIPDLCADSFTCPLCSKVGL
                     SAGQLMDHCQAKHHLMRTPVICPLCVAVPSSHPHMVTNLANHLALWHPSSILRDQESD
                     PESPESPLPHFPWRSFSGMGTGRATHHRLPSPQMPQVRFLVPRGTPPLATSEDLSDEE
                     IVEM"
     misc_feature    398..544
                     /gene="LOC108065473"
                     /note="Zinc finger, ZZ type. Zinc finger present in
                     potassium channel modulatory factor (PCMF) 1 and related
                     proteins. The ZZ motif coordinates two zinc ions and most
                     likely participates in ligand binding or molecular
                     scaffolding. Human potassium channel...; Region:
                     ZZ_PCMF_like; cd02338"
                     /db_xref="CDD:239078"
     misc_feature    order(404..406,413..415,449..451,458..460,476..478,
                     485..487,515..517,527..529)
                     /gene="LOC108065473"
                     /note="Zinc-binding sites [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    order(404..406,413..415,476..478,485..487)
                     /gene="LOC108065473"
                     /note="zinc cluster 1 [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    order(407..409,440..442,446..448,464..466,470..472)
                     /gene="LOC108065473"
                     /note="putative charged binding surface [active]"
                     /db_xref="CDD:239078"
     misc_feature    order(443..445,488..490,533..535,542..544)
                     /gene="LOC108065473"
                     /note="putative hydrophobic binding surface [active]"
                     /db_xref="CDD:239078"
     misc_feature    order(449..451,458..460,515..517,527..529)
                     /gene="LOC108065473"
                     /note="zinc cluster 2 [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    605..784
                     /gene="LOC108065473"
                     /note="Drought induced 19 protein (Di19), zinc-binding;
                     Region: zf-Di19; pfam05605"
                     /db_xref="CDD:428539"
ORIGIN      
        1 acgccccctc cttcccctcc gccccaataa gtcccccacc catttcgatt gcgactccga
       61 gacgtaaaca aaataaccca aaactgcccc actcaagtgt ctcgtgtttt gtgtttataa
      121 ccggcggaca aaaggttcca agtctgctcg gatattctta tcaccgccgg tcagtcgtcg
      181 ccagtttgtt aggggactcc aagtccgagg actcctgctc ctgatcctgc tcttcctcct
      241 tctgggtttt catcccggtc tcatcccgat tcactggttg ctggttcctg gttcctggtc
      301 ctgttcccac cgctcactta agccgctttg ggcatgcatg gagtcgccga cggggatcct
      361 tgaccgccag gactcggcta tgtcgctcca ctgggacatc aactgcgatg gctgcgggac
      421 gccgaggctg ctcctctacc gcttcaagtg cctgcgctgc ccggattacg acctgtgcgc
      481 cgagtgccac gaggacggaa tcaccggcgg cgatcacgag cggggtcacc ccttccagtg
      541 cctcctggac cgcgccgccc gtgagctgca ctttgggggc gggacgattc cggatctgtg
      601 cgccgacagc ttcacctgtc cgctgtgctc caaggtgggt ctgtcggccg ggcagttgat
      661 ggaccactgc caggcgaagc accacctgat gcgcaccccc gtcatttgcc ccctctgcgt
      721 ggcggtgcct tcctcgcatc cgcacatggt caccaacctg gccaaccacc tggccctctg
      781 gcatccgtcg agcattttgc gggatcagga gtctgaccct gagtccccgg aatccccgct
      841 gccccacttc ccatggcgct cgttctctgg aatgggaact ggaagggcca cccaccaccg
      901 tctgcccagc ccacaaatgc cgcaggtgcg cttccttgtg cccaggggca cgcccccctt
      961 ggccacgtcc gaggatctca gcgacgagga gatcgttgag atgtgagtcc ggaaaattaa
     1021 attaaaaata ataaatccaa gaaaataatc aggaaaatta gtatacggat tcttggtaca
     1081 aatataaatt tttgcttatg ttatcttctt gttacttggc caaaaaacag tatcaaaaat
     1141 acaatacact gttttaagta gccaacacag caaataaatt gat