Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218920 1183 bp mRNA linear INV 09-DEC-2024 (LOC108065473), transcript variant X1, mRNA. ACCESSION XM_070218920 VERSION XM_070218920.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1183 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1183 /gene="LOC108065473" /note="E3 ubiquitin-protein ligase Kcmf1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065473" CDS 338..1006 /gene="LOC108065473" /codon_start=1 /product="E3 ubiquitin-protein ligase Kcmf1 isoform X1" /protein_id="XP_070075021.1" /db_xref="GeneID:108065473" /translation="MESPTGILDRQDSAMSLHWDINCDGCGTPRLLLYRFKCLRCPDY DLCAECHEDGITGGDHERGHPFQCLLDRAARELHFGGGTIPDLCADSFTCPLCSKVGL SAGQLMDHCQAKHHLMRTPVICPLCVAVPSSHPHMVTNLANHLALWHPSSILRDQESD PESPESPLPHFPWRSFSGMGTGRATHHRLPSPQMPQVRFLVPRGTPPLATSEDLSDEE IVEM" misc_feature 398..544 /gene="LOC108065473" /note="Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel...; Region: ZZ_PCMF_like; cd02338" /db_xref="CDD:239078" misc_feature order(404..406,413..415,449..451,458..460,476..478, 485..487,515..517,527..529) /gene="LOC108065473" /note="Zinc-binding sites [ion binding]; other site" /db_xref="CDD:239078" misc_feature order(404..406,413..415,476..478,485..487) /gene="LOC108065473" /note="zinc cluster 1 [ion binding]; other site" /db_xref="CDD:239078" misc_feature order(407..409,440..442,446..448,464..466,470..472) /gene="LOC108065473" /note="putative charged binding surface [active]" /db_xref="CDD:239078" misc_feature order(443..445,488..490,533..535,542..544) /gene="LOC108065473" /note="putative hydrophobic binding surface [active]" /db_xref="CDD:239078" misc_feature order(449..451,458..460,515..517,527..529) /gene="LOC108065473" /note="zinc cluster 2 [ion binding]; other site" /db_xref="CDD:239078" misc_feature 605..784 /gene="LOC108065473" /note="Drought induced 19 protein (Di19), zinc-binding; Region: zf-Di19; pfam05605" /db_xref="CDD:428539" ORIGIN 1 acgccccctc cttcccctcc gccccaataa gtcccccacc catttcgatt gcgactccga 61 gacgtaaaca aaataaccca aaactgcccc actcaagtgt ctcgtgtttt gtgtttataa 121 ccggcggaca aaaggttcca agtctgctcg gatattctta tcaccgccgg tcagtcgtcg 181 ccagtttgtt aggggactcc aagtccgagg actcctgctc ctgatcctgc tcttcctcct 241 tctgggtttt catcccggtc tcatcccgat tcactggttg ctggttcctg gttcctggtc 301 ctgttcccac cgctcactta agccgctttg ggcatgcatg gagtcgccga cggggatcct 361 tgaccgccag gactcggcta tgtcgctcca ctgggacatc aactgcgatg gctgcgggac 421 gccgaggctg ctcctctacc gcttcaagtg cctgcgctgc ccggattacg acctgtgcgc 481 cgagtgccac gaggacggaa tcaccggcgg cgatcacgag cggggtcacc ccttccagtg 541 cctcctggac cgcgccgccc gtgagctgca ctttgggggc gggacgattc cggatctgtg 601 cgccgacagc ttcacctgtc cgctgtgctc caaggtgggt ctgtcggccg ggcagttgat 661 ggaccactgc caggcgaagc accacctgat gcgcaccccc gtcatttgcc ccctctgcgt 721 ggcggtgcct tcctcgcatc cgcacatggt caccaacctg gccaaccacc tggccctctg 781 gcatccgtcg agcattttgc gggatcagga gtctgaccct gagtccccgg aatccccgct 841 gccccacttc ccatggcgct cgttctctgg aatgggaact ggaagggcca cccaccaccg 901 tctgcccagc ccacaaatgc cgcaggtgcg cttccttgtg cccaggggca cgcccccctt 961 ggccacgtcc gaggatctca gcgacgagga gatcgttgag atgtgagtcc ggaaaattaa 1021 attaaaaata ataaatccaa gaaaataatc aggaaaatta gtatacggat tcttggtaca 1081 aatataaatt tttgcttatg ttatcttctt gttacttggc caaaaaacag tatcaaaaat 1141 acaatacact gttttaagta gccaacacag caaataaatt gat