Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218918 406 bp mRNA linear INV 09-DEC-2024 (LOC138913854), mRNA. ACCESSION XM_070218918 VERSION XM_070218918.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..406 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..406 /gene="LOC138913854" /note="uncharacterized LOC138913854; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913854" CDS 131..322 /gene="LOC138913854" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070075019.1" /db_xref="GeneID:138913854" /translation="MQKEARDIFPDDGFDVYLEVARLMQDVELIFVGEVEESIFEDIA FEEPYDGNSSSSEGSSDEE" ORIGIN 1 caatgttctc tgctgtcaaa ataaggagcc tgccaaactc acttacgtca attaatttca 61 cttttccagc ggaacgaatc gcacgaaatt taatttcttt tcaagtttgt gaactgctga 121 ccacaagaag atgcagaagg aagcaaggga tatctttccc gatgatgggt ttgatgtgta 181 tctagaggtc gcccgcctga tgcaagacgt tgaactgatt ttcgtgggcg aagtggagga 241 atcgatattt gaagacatcg cattcgagga accctacgat gggaactcaa gttcttcgga 301 agggagcagc gacgaggagt aattgtgcta ccatggacgt caagaatttc ctaaatttgg 361 ctggctatca gccaatgtcg tccaataaag ttctgtagca tattgt