Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218918             406 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913854), mRNA.
ACCESSION   XM_070218918
VERSION     XM_070218918.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..406
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..406
                     /gene="LOC138913854"
                     /note="uncharacterized LOC138913854; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913854"
     CDS             131..322
                     /gene="LOC138913854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070075019.1"
                     /db_xref="GeneID:138913854"
                     /translation="MQKEARDIFPDDGFDVYLEVARLMQDVELIFVGEVEESIFEDIA
                     FEEPYDGNSSSSEGSSDEE"
ORIGIN      
        1 caatgttctc tgctgtcaaa ataaggagcc tgccaaactc acttacgtca attaatttca
       61 cttttccagc ggaacgaatc gcacgaaatt taatttcttt tcaagtttgt gaactgctga
      121 ccacaagaag atgcagaagg aagcaaggga tatctttccc gatgatgggt ttgatgtgta
      181 tctagaggtc gcccgcctga tgcaagacgt tgaactgatt ttcgtgggcg aagtggagga
      241 atcgatattt gaagacatcg cattcgagga accctacgat gggaactcaa gttcttcgga
      301 agggagcagc gacgaggagt aattgtgcta ccatggacgt caagaatttc ctaaatttgg
      361 ctggctatca gccaatgtcg tccaataaag ttctgtagca tattgt